KEGG   Drosophila persimilis: Dper_GL26506Help
Entry
Dper_GL26506      CDS       T01063                                 

Definition
GL26506 gene product from transcript GL26506-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpe  Drosophila persimilis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dper_GL26506
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dper_GL26506
Translation factors [BR:dpe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dper_GL26506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 219 aa AA seqDB search
MVYTGYDGSALYPAMGGHMTISGEASPNEVRNLLDYGVLIKHPLEHTWTVWHWENDRSKN
WSDMLNEVTSFNTVEDFFTVYYFIKPPSQLSVFNDYMVFKQGVRPMWEDDINKDGGRWII
MLDKNTKAMNDKLWQDLLLCSIGECFQHSNEINGVVINVRNKANKLSLWTRNSANAHAVL
TLGQQLKGLLKLTNVEIQYQAHKDAMVQHGPNFNAMYKL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatacgggctacgatggttctgctttgtacccagctatgggcgggcacatgacc
atatcgggcgaggcttcgcccaatgaagtgaggaacctcctggactatggggtgcttata
aagcatcctctggagcacacctggacggtgtggcattgggagaatgatcgctcaaagaac
tggagcgatatgcttaatgaagtgacaagcttcaatacggttgaagatttctttactgtg
tactattttatcaagccaccatctcagctaagcgtcttcaacgattatatggtattcaag
cagggagtgcgtcccatgtgggaggatgatattaacaaagatggcggccgttggattata
atgttggacaaaaacaccaaggccatgaatgacaagttgtggcaggatttgcttttgtgc
agcattggcgagtgcttccaacactcgaatgagatcaacggtgttgtcatcaatgtgcgc
aacaaggccaacaagttgtctctctggaccagaaactcggctaatgctcacgctgtgctg
accctgggccagcagttaaagggactgctaaaattgaccaacgttgagatacagtaccag
gcccacaaggatgccatggtccagcatggacctaattttaatgcaatgtataagttgtaa

DBGET integrated database retrieval system