KEGG   Drosophila persimilis: Dper_GL26664Help
Entry
Dper_GL26664      CDS       T01063                                 

Definition
GL26664 gene product from transcript GL26664-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dpe  Drosophila persimilis
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dpe00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MALKLRIAIIGQSNFAADVLELLLERSNIQIVGVFTIPDKGSREDVLATTAAAHKIPVFK
FSSWRRKGVALPEVLAQYKSVGATLNVLPYCSQFIPMEVIDGASLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDSIYKRFLYPEGVKA
MGVAVDMVANGTAPKITQTEIGATYDPAMFKADNQLINLQQPAERIWNFVRGLDSVPGAI
ATVLLQDGTEEQIRLFGAHLYSAGPVSNGQPLRLQGLTKPAWIHASGLLIEGTDGAFVNV
RRIKRGSKVINASEWFKQAEQQPITDFSEDELSKKGILSAIWQAILKEPIEGSTDFFAAG
AGSMDVVRLVEEVKEAFDVPLENDNVFMAPVFEEFFGQLVKILRQGSGGSGGQQLIYEGF
TLKANKREIQVPTQLFIDGEFVDAEGKRTLEIVNPTDEKVLCKVACASPKDVDKAVKAAH
AAFYGSWKQVSARQRGQLMLNLADLMEKHKEELATIESVDSGAVYTLALKTHIGMSIDAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLVTPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVKAGFPPGVINVLPGKGSDAGQAVADHQLVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDLDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFVRRVLKDLRTMTIGDPLNRSTAHGPQNHKAHFEKLLEFCERGVKDGA
TLVYGGCRVPNLKGYFFTPTVFTNVEDDMFIAQEESFGPIMIISKFNGSDIDSVMQRANS
TEYGLASGVFTKDISKALSFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTIEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaacttcgcattgccatcattggccagagtaactttgctgccgatgtgctg
gagcttctgctggagcgttcgaacatacaaattgttggcgtcttcaccataccggacaag
gggagtcgcgaggatgtgctggccaccactgccgcagcccacaagatacccgtctttaag
tttagcagctggcggcggaagggcgtggctctgccggaggttttggcacaatataaatcg
gtgggcgccaccttgaatgtgctgccgtactgttcgcagttcattccaatggaggtgatt
gatggggcctcattgggaagcatttgctaccatccatcgatcctgccacgccatcgcggt
gccagtgccatatcctggaccctgattgagggcgacgaggtggctggctttagtatcttt
tgggcggatgatggcctggacactggaccattgctgttgacgcgtcagacgaatctcgag
cccaccgacacactggacagcatctacaagagattcctgtatcccgagggcgtcaaggcc
atgggtgtggccgtggacatggtggccaatggcacggctccaaagataacccaaacggag
atcggggccacctacgatccggccatgttcaaggccgataatcagttgatcaatctgcag
caaccggcggagcggatctggaactttgtgcggggcttggactccgtgcctggggccata
gccacagttctgctgcaggacggcaccgaggagcagatacgtctctttggcgcccatctg
tattccgctggtcccgtgtcgaatggccagccactgcgactgcagggtctcacgaaaccc
gcttggattcacgcctcgggtcttctgatcgaaggcaccgatggggcgttcgtgaacgtc
cgtcgcatcaagcgtgggtcaaaggtgatcaatgccagcgaatggttcaagcaggccgag
cagcagcccatcacagacttctccgaggatgagctatccaagaagggtatcctttctgcc
atttggcaggctattttgaaggagcccattgagggttccacagatttctttgccgctggc
gcgggctccatggatgtggtgcgtctggtggaggaagtaaaggaagccttcgatgtccca
ctcgagaatgataatgtctttatggctcccgtgtttgaggagttctttggacagctcgtt
aaaattctgcgtcaaggcagtggcggctctggtgggcagcagctcatctacgaaggtttc
actctgaaggcaaacaaaagggagattcaggtgcccacacagctcttcatcgatggggag
tttgtggatgccgagggcaagcgcaccttggagattgtgaatcccacagacgagaaggtc
ctctgtaaagtggcctgtgcctctcccaaggatgtggacaaggcagtaaaggctgcccac
gctgctttctatggctcgtggaagcaggtttcggcccggcagcgtggtcaactgatgctc
aatctagctgatctcatggagaagcacaaggaggagcttgcaaccatcgaatcggtggat
tcgggtgcggtctacaccctggccctgaagacccacattggcatgtccatcgatgcctgg
cggtattttgccggatggtgcgataagatccaagggaacaccatacccgtgaaccccgcg
agacccaataacgtcctgaccttcacgcggaaggagcccattggcgtgtgtggcttggtc
accccatggaactatcctttgatgatgctctcctggaagatggccgcctgcattgctgct
ggcaatacctgtctgatcaagcccgcccaaacgtgtcctttgactgctctgaaattcgct
gagctgacagtcaaggcgggttttcctccgggtgtgattaatgtcctgcctggcaagggt
tccgatgctggtcaggcggtggccgatcatcaattggttcggaagctgggcttcacggga
tccacgcccattggcaagcacattatgaagtcctgtgcggactccaatctcaagaagtgc
tcgctagagctgggaggcaagtctcctttgattatctttgcggattgtgacctagacaaa
gcggtgaagcatggcatgtcttctgttttcttcaacaagggagaaaattgcattgctgct
ggccgactctttgtggaggatcgcattcatgacgagtttgtgcggcgtgtgctcaaggat
ctccgcaccatgaccattggggatcccctgaatcgctctacagcccatggcccgcagaac
cacaaggcacactttgagaagctgctggagttctgtgagcgaggtgtgaaggacggagcc
acactggtgtacggcggctgtcgtgttccgaatctcaagggctacttctttactcccacg
gtgttcacgaatgtcgaggatgatatgttcatagcgcaggaggagtcctttgggcccatc
atgatcatctccaagttcaatggcagcgacatcgactcggtcatgcagagggccaacagc
acggagtacggactggccagcggtgtctttaccaaggacattagcaaggctctcagcttc
gcggaccgcattgaggccggcaccgtgtttgtgaatgtctacaacaagacagacgtggca
gcgccatttggcggcttcaagcagagcggctacggcaaggacctgggtcaagaggccctc
aacgagtatctcaagaccaagtgtgtgacaattgaatattga

DBGET integrated database retrieval system