KEGG   Drosophila persimilis: Dper_GL26668Help
Entry
Dper_GL26668      CDS       T01063                                 

Definition
GL26668 gene product from transcript GL26668-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dpe  Drosophila persimilis
Brite
Ribosome [BR:dpe03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dper_GL26668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 196 aa AA seqDB search
MLPIARGIYNGLASITRNSRGALHTASAFRCKAATENEAEAVDGEEEPKSSGPDPKDRTQ
VIPVETSIRYLKSVAYKETYGDDFVWSQYRRNHKGMYAPRKTRKTCIRQGKISTGNPCPI
CRDEYLVLDYRNTELLEQFISPHNGEVLSYSKTGLCQKSHLRLRVAVEQARDSGLITYDV
PFREYDYNEFYGQQKS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccattgcgcgagggatatacaatggtttggctagcataacgcgcaacagccgg
ggagctttgcatacagccagcgccttcagatgcaaggctgcaacggaaaatgaagcggag
gcggtcgatggcgaagaggagccaaagagctctggtccggaccccaaagatcgcacccaa
gtgatacctgtggaaacatcaatacgttatctgaagagtgtcgcgtataaggagacctat
ggcgacgatttcgtgtggtctcaatatcggcgcaaccacaagggcatgtatgcgccacgc
aagacccgcaagacttgcattcgccagggcaaaatatccaccggtaatccttgtcccatt
tgtcgcgatgagtatctcgtcctggattaccgcaacacggaactactggagcagttcatt
tcgccgcacaatggagaggtcctcagctactcgaagacgggtctatgccagaaaagtcat
ttgcgtttgagggtggcggtggagcaggcccgggattctggcctcataacctacgatgtg
ccattcagagagtatgactacaacgagttctatggccagcaaaagtcctaa

DBGET integrated database retrieval system