KEGG   Drosophila persimilis: Dper_GL27142Help
Entry
Dper_GL27142      CDS       T01063                                 

Definition
GL27142 gene product from transcript GL27142-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dpe  Drosophila persimilis
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dpe00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dpe04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpe04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dpe04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpe04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1103 aa AA seqDB search
MNRTASVSHNYAACLLDNRQASYADLTYPGCDMPPTEYAPSDMRFSINLWKNDPPDYVDL
ICMIPNGTLLMMKAPSSTTIREIKVEVVKMAKQNCLGYMIKDACDYQFYGISVFNIEPYT
DETKRLCEVQPHFGLLSLGDRTDATSFSSDYELTKMVSGMIGNSFDHHRTQGTPEIDDFR
RSMTDLCESIEVERSQFTWQQRLLYEHPLRLAGSVDMPELIRQRHPTSAFLIVVKNENDQ
STFTLSVMEKDTPFSLIESTLQKMNRSQMKMNDRAGDYILKVSGRDEYLFGDHPLIQFLY
IQEALSDSAVPNVVLQSVIRMESYINHHNEQSMGLKRAPKKDRSVVLHKAPTSLWDLGNY
FQLTLHSISNVNYDKTRAFRVGVDVGLYHGEHKLCSQRSIDAPNGSSDTFLFNDQIMDFD
IQMRNLPRMTRLCIVIFEVTKLSRSKKSSNNKDNAQKDVSYNKNPLAWVNTTLLDYKAHL
RTGRQVLYTWTYADDIQSDEVFHPLGTIEPNPRKEECALVHVTFHSSGAESVRYPCENTV
LQYAADRALASLREKQQQPAEPEKPLKDLKELVANYTGLDKIYEMVDQDRNAIWERRNDV
LRELPEQLPILLHCVYWKERDDVADIWYLLKRWPLISVERSLELLDYAYPDPAVRRFAIK
CLQILKDDDLLLYLLQLVQAIKHESYLESDLVVLLLERALRNQRIGHYFFWHLRSEMQTP
SMQTRFGLLLEVYLKGCKHHVAPLRKQLQVLDKLKQVSVLAKKGSKEKVKTMLQDFLRDQ
RNTGVFQNIQNPLNPSFRCSGVSPDQCKVMDSKMRPLWVVFENADLNSNDVYIIFKNGDD
LRQDMLTLQMLRVMDKLWKRDGMDFRMNIYNCISMEQRLGMIEVVRHAETIANIQKEKGM
FSATSPFKKGSLYSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVK
RNGQLFHIDFGHILGHFKEKFGVRRERVPFVLTHDFVYVINKGCNDREAKEFCHFQELCE
HAFLTLRKHGCLILSLFSMMISTGLPELSSEKDLNYLRDTLVLDYTEEKAREHFRAKFSE
ALANSWKTSLNWASHNFSKNNKQ
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaccgcctccgtttcccacaattatgctgcctgtttgctggacaaccggcaa
gcgtcctatgcagacctcacgtacccaggctgcgacatgcccccgaccgagtacgcccca
tccgacatgagattctctatcaatctgtggaagaacgatccgcccgactatgtcgatctc
atatgcatgatcccgaatggcaccctgctgatgatgaaggccccctcgtcgaccacgata
cgggaaatcaaggtggaggtcgtcaagatggcgaaacagaactgcctgggctatatgatc
aaggatgcgtgcgactatcagttctacggaatctctgtgttcaacatcgaaccctacacg
gacgagacgaagcgcctgtgcgaggtgcagccccactttggtctactcagcctgggcgac
cgcaccgatgccaccagcttctccagcgactacgaactaacgaagatggtcagcggcatg
attggcaactcattcgaccatcaccgaacccaaggcacgcccgagatcgacgactttcga
cgcagcatgacagatctctgcgagagcatcgaggtggagcgttcccagttcacgtggcag
cagcgtctcctctatgagcatcccctgaggctggccggctcggtggatatgcccgagcta
atacgtcagcgtcatccaacatccgcttttctgatagtcgtaaagaacgagaacgatcag
agcacgttcacgctgtctgtcatggagaaggacaccccgttctcgctgatcgagagcacg
ttgcagaagatgaaccgatcgcagatgaagatgaacgatcgcgccggcgactatatactg
aaagtgagcggccgcgatgagtatctgttcggcgatcatccgctgatacagttcctgtac
atccaagaagcactctcggactcggccgtgcccaatgtggtgctgcagtcggtgatccgc
atggagtcgtacatcaatcaccacaacgagcagagcatgggcctgaagcgagcccccaag
aaggaccggtccgtggtgctccataaggcacccacatcgctgtgggatttgggcaactac
tttcagctgacgctgcacagcatcagcaacgtcaactacgacaagacacgggcgttccgg
gtgggcgttgatgtggggctgtatcatggcgagcacaagctgtgctcgcagcgatcgata
gatgcgcccaatggcagctcggacacgttcctcttcaacgatcagatcatggactttgac
atacagatgcgcaatctcccgcggatgacgcgattgtgcatcgtcatctttgaggtgacc
aaattgtcgcgctccaagaagtcatccaacaacaaggacaacgcccagaaggacgtgtcg
tacaacaagaatcccctggcctgggtcaatacaacgcttctggactacaaggctcatttg
cgaactggccgacaggtgctgtacacgtggacatatgcggacgatatacagtcggacgag
gtgttccacccgctgggcaccatcgaaccgaatccgcgcaaggaggagtgcgccctggtg
cacgtaacattccacagcagtggcgccgaatccgtgcgctatccctgcgagaatactgtc
ttgcaatatgcagcggatcgagcgctggccagcctccgcgagaagcaacagcagccggca
gagcccgagaaaccactgaaagacctcaaggagttggtggccaactacaccggcctggac
aagatctatgagatggtggaccaggatcgcaatgccatttgggagcgcaggaatgatgtc
ctccgcgaattgccagaacagctgccgatcctcttgcactgtgtgtactggaaggagcgc
gacgatgtggccgacatctggtacctcctcaagcggtggccgctcatctcggttgaacga
tcactggaactgctggactatgcatatccagatccagccgttcgtcgatttgccatcaag
tgtctacaaattctcaaggatgatgatctgctattgtacctgctccaactggtgcaggcc
atcaagcacgaatcgtatctggagagtgatctggttgtgttactgctggagcgagcgctg
cgcaatcaacgcatcggccactacttcttctggcatctgcgatccgagatgcaaacgcct
tcgatgcagacacggttcggcctcctgctggaggtctatctcaagggctgtaagcatcat
gtggcgccgctgcggaaacagctgcaggtgctcgacaaactgaagcaggtctctgtttta
gccaagaagggcagcaaggaaaaggtgaaaaccatgctgcaggactttctgagggatcag
cggaacacgggcgtcttccagaacatacagaacccactgaatcccagctttcggtgtagc
ggcgtctcgcctgaccagtgcaaggtgatggacagtaagatgcgtccgctgtgggtggtg
ttcgagaatgccgatctgaactcgaacgatgtgtacattatattcaaaaatggcgatgat
ctgcgccaggacatgctcacactgcagatgctgcgggtgatggacaagttgtggaaacga
gacggcatggactttcgcatgaacatctacaactgcatcagcatggagcagcgcctgggc
atgattgaggtggtgcggcatgcggagacgattgccaacatacagaaggagaagggaatg
ttctcggccacgtcgccgttcaagaagggctcgctgtacagttggctcaaggagcacaac
aagcccgctgataagctgaacaaggccatcaacgagttcacgcttagctgtgccggctac
tgtgtggccacctatgtactgggcgtggccgatcgtcattccgacaacataatggtcaag
aggaacggacagctctttcacatcgactttggacacatcttgggacacttcaaggagaag
tttggtgtgcgtcgtgagcgtgtaccgtttgtgctaacccacgattttgtgtacgtcatc
aacaagggctgtaatgatcgcgaggcgaaagagttttgtcactttcaggaattgtgcgag
cacgcatttttaacattacgcaaacacggctgccttatcttatcgctgttctcgatgatg
atttcaacaggactgccggaactgtcctccgagaaggacttgaactatctacgcgacact
ttggtgctggactatacggaggaaaaagcacgcgaacatttccgggcgaaattcagcgaa
gctttggccaactcctggaaaacttctctaaattgggcctcgcacaatttctccaagaac
aacaaacagtaa

DBGET integrated database retrieval system