KEGG   Drosophila persimilis: Dper_GL27142Help
Entry
Dper_GL27142      CDS       T01063                                 

Definition
GL27142 gene product from transcript GL27142-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dpe  Drosophila persimilis
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dper_GL27142
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dper_GL27142
   04068 FoxO signaling pathway
    Dper_GL27142
   04070 Phosphatidylinositol signaling system
    Dper_GL27142
   04150 mTOR signaling pathway
    Dper_GL27142
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dper_GL27142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1103 aa AA seqDB search
MNRTASVSHNYAACLLDNRQASYADLTYPGCDMPPTEYAPSDMRFSINLWKNDPPDYVDL
ICMIPNGTLLMMKAPSSTTIREIKVEVVKMAKQNCLGYMIKDACDYQFYGISVFNIEPYT
DETKRLCEVQPHFGLLSLGDRTDATSFSSDYELTKMVSGMIGNSFDHHRTQGTPEIDDFR
RSMTDLCESIEVERSQFTWQQRLLYEHPLRLAGSVDMPELIRQRHPTSAFLIVVKNENDQ
STFTLSVMEKDTPFSLIESTLQKMNRSQMKMNDRAGDYILKVSGRDEYLFGDHPLIQFLY
IQEALSDSAVPNVVLQSVIRMESYINHHNEQSMGLKRAPKKDRSVVLHKAPTSLWDLGNY
FQLTLHSISNVNYDKTRAFRVGVDVGLYHGEHKLCSQRSIDAPNGSSDTFLFNDQIMDFD
IQMRNLPRMTRLCIVIFEVTKLSRSKKSSNNKDNAQKDVSYNKNPLAWVNTTLLDYKAHL
RTGRQVLYTWTYADDIQSDEVFHPLGTIEPNPRKEECALVHVTFHSSGAESVRYPCENTV
LQYAADRALASLREKQQQPAEPEKPLKDLKELVANYTGLDKIYEMVDQDRNAIWERRNDV
LRELPEQLPILLHCVYWKERDDVADIWYLLKRWPLISVERSLELLDYAYPDPAVRRFAIK
CLQILKDDDLLLYLLQLVQAIKHESYLESDLVVLLLERALRNQRIGHYFFWHLRSEMQTP
SMQTRFGLLLEVYLKGCKHHVAPLRKQLQVLDKLKQVSVLAKKGSKEKVKTMLQDFLRDQ
RNTGVFQNIQNPLNPSFRCSGVSPDQCKVMDSKMRPLWVVFENADLNSNDVYIIFKNGDD
LRQDMLTLQMLRVMDKLWKRDGMDFRMNIYNCISMEQRLGMIEVVRHAETIANIQKEKGM
FSATSPFKKGSLYSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVK
RNGQLFHIDFGHILGHFKEKFGVRRERVPFVLTHDFVYVINKGCNDREAKEFCHFQELCE
HAFLTLRKHGCLILSLFSMMISTGLPELSSEKDLNYLRDTLVLDYTEEKAREHFRAKFSE
ALANSWKTSLNWASHNFSKNNKQ
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaccgcctccgtttcccacaattatgctgcctgtttgctggacaaccggcaa
gcgtcctatgcagacctcacgtacccaggctgcgacatgcccccgaccgagtacgcccca
tccgacatgagattctctatcaatctgtggaagaacgatccgcccgactatgtcgatctc
atatgcatgatcccgaatggcaccctgctgatgatgaaggccccctcgtcgaccacgata
cgggaaatcaaggtggaggtcgtcaagatggcgaaacagaactgcctgggctatatgatc
aaggatgcgtgcgactatcagttctacggaatctctgtgttcaacatcgaaccctacacg
gacgagacgaagcgcctgtgcgaggtgcagccccactttggtctactcagcctgggcgac
cgcaccgatgccaccagcttctccagcgactacgaactaacgaagatggtcagcggcatg
attggcaactcattcgaccatcaccgaacccaaggcacgcccgagatcgacgactttcga
cgcagcatgacagatctctgcgagagcatcgaggtggagcgttcccagttcacgtggcag
cagcgtctcctctatgagcatcccctgaggctggccggctcggtggatatgcccgagcta
atacgtcagcgtcatccaacatccgcttttctgatagtcgtaaagaacgagaacgatcag
agcacgttcacgctgtctgtcatggagaaggacaccccgttctcgctgatcgagagcacg
ttgcagaagatgaaccgatcgcagatgaagatgaacgatcgcgccggcgactatatactg
aaagtgagcggccgcgatgagtatctgttcggcgatcatccgctgatacagttcctgtac
atccaagaagcactctcggactcggccgtgcccaatgtggtgctgcagtcggtgatccgc
atggagtcgtacatcaatcaccacaacgagcagagcatgggcctgaagcgagcccccaag
aaggaccggtccgtggtgctccataaggcacccacatcgctgtgggatttgggcaactac
tttcagctgacgctgcacagcatcagcaacgtcaactacgacaagacacgggcgttccgg
gtgggcgttgatgtggggctgtatcatggcgagcacaagctgtgctcgcagcgatcgata
gatgcgcccaatggcagctcggacacgttcctcttcaacgatcagatcatggactttgac
atacagatgcgcaatctcccgcggatgacgcgattgtgcatcgtcatctttgaggtgacc
aaattgtcgcgctccaagaagtcatccaacaacaaggacaacgcccagaaggacgtgtcg
tacaacaagaatcccctggcctgggtcaatacaacgcttctggactacaaggctcatttg
cgaactggccgacaggtgctgtacacgtggacatatgcggacgatatacagtcggacgag
gtgttccacccgctgggcaccatcgaaccgaatccgcgcaaggaggagtgcgccctggtg
cacgtaacattccacagcagtggcgccgaatccgtgcgctatccctgcgagaatactgtc
ttgcaatatgcagcggatcgagcgctggccagcctccgcgagaagcaacagcagccggca
gagcccgagaaaccactgaaagacctcaaggagttggtggccaactacaccggcctggac
aagatctatgagatggtggaccaggatcgcaatgccatttgggagcgcaggaatgatgtc
ctccgcgaattgccagaacagctgccgatcctcttgcactgtgtgtactggaaggagcgc
gacgatgtggccgacatctggtacctcctcaagcggtggccgctcatctcggttgaacga
tcactggaactgctggactatgcatatccagatccagccgttcgtcgatttgccatcaag
tgtctacaaattctcaaggatgatgatctgctattgtacctgctccaactggtgcaggcc
atcaagcacgaatcgtatctggagagtgatctggttgtgttactgctggagcgagcgctg
cgcaatcaacgcatcggccactacttcttctggcatctgcgatccgagatgcaaacgcct
tcgatgcagacacggttcggcctcctgctggaggtctatctcaagggctgtaagcatcat
gtggcgccgctgcggaaacagctgcaggtgctcgacaaactgaagcaggtctctgtttta
gccaagaagggcagcaaggaaaaggtgaaaaccatgctgcaggactttctgagggatcag
cggaacacgggcgtcttccagaacatacagaacccactgaatcccagctttcggtgtagc
ggcgtctcgcctgaccagtgcaaggtgatggacagtaagatgcgtccgctgtgggtggtg
ttcgagaatgccgatctgaactcgaacgatgtgtacattatattcaaaaatggcgatgat
ctgcgccaggacatgctcacactgcagatgctgcgggtgatggacaagttgtggaaacga
gacggcatggactttcgcatgaacatctacaactgcatcagcatggagcagcgcctgggc
atgattgaggtggtgcggcatgcggagacgattgccaacatacagaaggagaagggaatg
ttctcggccacgtcgccgttcaagaagggctcgctgtacagttggctcaaggagcacaac
aagcccgctgataagctgaacaaggccatcaacgagttcacgcttagctgtgccggctac
tgtgtggccacctatgtactgggcgtggccgatcgtcattccgacaacataatggtcaag
aggaacggacagctctttcacatcgactttggacacatcttgggacacttcaaggagaag
tttggtgtgcgtcgtgagcgtgtaccgtttgtgctaacccacgattttgtgtacgtcatc
aacaagggctgtaatgatcgcgaggcgaaagagttttgtcactttcaggaattgtgcgag
cacgcatttttaacattacgcaaacacggctgccttatcttatcgctgttctcgatgatg
atttcaacaggactgccggaactgtcctccgagaaggacttgaactatctacgcgacact
ttggtgctggactatacggaggaaaaagcacgcgaacatttccgggcgaaattcagcgaa
gctttggccaactcctggaaaacttctctaaattgggcctcgcacaatttctccaagaac
aacaaacagtaa

DBGET integrated database retrieval system