KEGG   Drosophila persimilis: Dper_GL27176Help
Entry
Dper_GL27176      CDS       T01063                                 

Definition
GL27176 gene product from transcript GL27176-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dpe  Drosophila persimilis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dper_GL27176
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dper_GL27176
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dper_GL27176
Transcription machinery [BR:dpe03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dper_GL27176
Spliceosome [BR:dpe03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dper_GL27176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MADVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtcatgaatatcgacagcataatatcacgtcttctcgaggtgcgtggggca
cggccaggcaaaaacgttcagctctctgagggcgaaattcgtgggctctgcctcaagtcg
cgcgagatattcctctcgcagcccattctgttggagttggaagccccgttgaagatttgc
ggcgacattcacggtcaatactacgacttgctgcgactttttgaatacggtggctttcca
ccggagtcaaattacttgtttttgggcgactacgtcgaccgtggcaaacaatcgctggaa
accatctgtctgctcctggcctacaagatcaaatattcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcataaaccgcatctatggattctacgatgagtgcaagcgc
cgctacagcatcaagctttggaagacgtttacggactgcttcaattgtcttcccgtggcg
gccattgttgacgagaagatattctgttgccatggcggtctgagtccggatttgacttcg
atggagcaaatccgacgcattatgcgccccactgatgtcccggatcaaggtctgttgtgc
gatctgctgtggtccgatccggacaaggataccatgggctggggagagaacgatcgcggc
gtgagcttcacattcggagccgaagtggtggctaaattcttgcagaagcacgagttcgat
ctcatctgccgtgcccatcaggtggtcgaggatggctacgagttctttgcgaagaggcag
ctggtcaccctgttctcggcacccaactactgcggtgaattcgacaatgctggcgccatg
atgtccgtggacgacacactgatgtgctcgttccagatcttgaagccggcagacaaacgt
aaaaagtaa

DBGET integrated database retrieval system