KEGG   Drosophila persimilis: Dper_GL27217Help
Entry
Dper_GL27217      CDS       T01063                                 

Definition
GL27217 gene product from transcript GL27217-RA
Orthology
K04437  
filamin
Organism
dpe  Drosophila persimilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1586 aa AA seqDB search
MYNGEIERRENAGARETPSAIVASKAFSTRNSNDADDGPVPVPISVHANYTNGGQTAATQ
ATIFLSHSNNSHHLNNRKNPPNFQTNACVNGNNHTEQNASQFVPNFSNLNFYAQQPTSAQ
NNNNKNYDVCHQQPNDYYQQQQQQQPADQYEENFDEDMEAERDLAEDAQWKKIQQNTFTR
WANEHLKTIDRSINNLETDLSDGLRLIALLEVLSQKRLPKYNKRPTFRSQKLENVSVALK
FLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGPTPKQ
RLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDSKDAVQNASEAMG
LADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPG
IEPIGPVVGAPANFTVETFSAGKGAVDVDIEGPNGEIEKADVRFNNDKNLTYTVSYIPKA
EGPHKVTVQFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPTGVTIKKPTFFDILAKD
AGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSINVFYAGTAIPNSPF
PVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGMNQNVM
QSKVDGNTYDCHYYPTKEGRYVIMVTFAGQEVPKSPFEVKVGPKKESSIVAYGPGLSSCR
KHRGIFAQRIHRGAHNQSGSENNSTEVKMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHE
LVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGITGEPANFTISTKGASAGGLTMA
VEGPSKAVINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDRHIKGSPYFAKITGEGRKRNQ
ISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPRETGEHL
VSVKRLGKHISNSPFKVTVCEREVGDAKKVNVSGAGLKEGQTHADNIFSVDTRNAGFGGL
SVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSN
RKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEIEDGLY
SVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAE
FNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPD
SPFKVYVSPDAGDAHKLEVQHFPQGNIQADAPYQFMVRKNGAKGDLDARIVAPSGTDDDC
FIQAIDSEMTSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKNVADPAAVHATGNGLE
EVKTGHKADFIINTCNAGVGTLHVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVK
YNNVHIVGSPFKVDAVGDKLADEGAQETSTVILETVQKVAKGGKNTGVHLPNFKSDASKV
VPKGMGLNRAYIGKQNQFSICATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLV
RDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacggagagatagagagacgcgaaaatgccggtgcgcgagaaactccgtcggcg
atcgtcgcgtcaaaagcattttcgacgcgcaacagtaacgacgctgacgacggtcccgtc
ccagtcccaatatccgttcacgcgaattatacaaacggtggtcagacggcggcgacacag
gcgaccatattcctcagccacagcaacaatagccatcatctcaacaatagaaaaaacccg
ccaaatttccagacaaacgcgtgtgtcaacggcaacaaccatacagagcagaacgcatcg
caatttgtgccaaattttagcaatttaaatttttacgcccaacagccaacgtcagcacag
aacaacaacaacaagaactacgacgtttgccatcaacagccgaacgactattaccaacaa
cagcagcagcagcagccggcggaccagtacgaggagaacttcgacgaagacatggaggcc
gaacgtgatcttgccgaggatgcgcagtggaagaagatccaacagaacaccttcacacgg
tgggcgaacgagcacctgaagaccatcgatcggtcgataaacaatctggaaacggatctg
tccgatggcctgcggctgatcgccctcctcgaggtgctgtcccagaagcgtttgcccaag
tataacaaacgtccaacattccgcagccagaaattggagaacgtatcggtggccctgaaa
ttccttcaggatgagggcatcaaaatcgttaacattgactcctcggacattgtggactgc
aagctgaaactgatactgggcctgatatggacgctcattctccactactcgatatcgatg
cccatgtgggatggcgaggatgagaagcagctgaacggctccggaccgacgcccaagcag
cgcctactgaactggatacatgccaagatacccgatttgcccatcaataacttcaccaat
gactggaccactggcaaggcggtgggcgctttggttgatgcctgtgccccgggtctgtgc
cccgactgggagatgtgggactcgaaggatgctgtccagaatgcatcggaggccatgggt
ctggccgacgattggttgaatgtccgtcagctgatcaagcccgaggagctggtcaatccc
aatgtcgatgagcagtccatgatgacgtacttgtcgcagtatcccaactctaagctgaag
acgggagcaccactgaggcccaagacgaaccccaacagagtgcgtgcctatggtcctgga
attgagccaattggtcctgtggttggtgccccagccaatttcacagtggaaaccttctcc
gctggcaagggtgctgtcgatgtggacatcgaggggcccaacggagagatcgaaaaggcc
gatgtgcgcttcaacaatgacaagaatctcacatacacggtctcgtacatacccaaggcc
gagggaccgcacaaggtgaccgttcagttctctggccgcgacatacccaagtctccgttc
cccgtaaaggtggagggacatgccggcgatgcttcaaaggtgaaggtaactggccccggt
atccagcccacgggagtgaccatcaagaagcccacattcttcgacatcctcgccaaggac
gcgggtcgcggcgtgcccgaggtgatcatcatcgatccggccaaccacaagacctcggtg
gcagccaaggtgcgccagttggagaacgatacttggcgctgcgaatacgtgacggccctg
cagggcctgcactccatcaatgtgttctatgcgggcactgctatcccgaacagtccgttc
cccgtgaaggtggcgccgctgtcggacgcccgcaaggtgcgcgcctccggacgcggcctc
caggccacgggcgtgcgtgttggggacgatgccgacttcaaaatccacaccgagggagcc
ggcgagggtgtgcccgaggtgcgcgtcattgggcccgggggcatgaaccagaacgtcatg
caatcaaaggtcgatggcaacacctacgactgccactactaccccaccaaggaggggcgg
tacgtgatcatggtgacctttgccgggcaggaagtgcccaagtccccgttcgaggtgaag
gtcgggcccaagaaggagtcctccattgtggcctatgggccgggactgagcagctgtcga
aagcatcgaggaatattcgcacagcgaatacatcgaggagcacacaaccaaagtggttca
gaaaacaactcaactgaagtcaaaatgccaagcggtaaggtagacaaacccgttatccag
gacaaccgtgatggaaccgtctcggtgaagtacgacccccgcgaagagggctcccacgag
ctggtcgtcaaatacaatggagaacccgtccaaggttctcccttcaaattccacgtcgat
tcgatcacctctggctatgtgacggcctacggaccgggcctgacccacggcatcactggc
gaacccgccaacttcaccatctcgaccaagggagccagcgccggtggcctgaccatggcc
gtcgagggacccagcaaggcagttatcaactaccatgacaacaaagacggcactgtatcg
gtgcaatacctgcccacagcgccgggcgagtaccaggtgtcggttcgcttcggcgacagg
catatcaagggatccccgtactttgccaagatcaccggcgagggtcgcaagcgcaaccag
atctcggtgggctcttgctcggaggtgaccatgcccggcgacatcaccgacgatgatctg
cgcgccctgaacgcctccatacaggcgcccagcggcctggaggagccgtgcttcctcaag
cgcatgcccaccggcaacattggcatttcgttcacgccccgcgagaccggcgagcatctg
gtctcggtgaagcgcctgggcaagcacatcagcaactcgcccttcaaggtcactgtctgt
gagcgcgaggtgggagatgccaagaaggtcaacgtgagcggagccgggctcaaggagggc
caaacgcacgcggacaacatcttctcggtggacacccgcaacgccggcttcggcggtctc
tccgtctcgatcgagggtcccagcaaggccgagatccaatgcacggacaaggacgatggc
accctaaacatctcgtacaagcccaccgagccaggctactatattgtcaatctgaagttc
gccgatcatcacgtggaaggatcacccttcaccgtcaaggtggccggtgagggcagcaac
cggaagcgggagaagattcagcgggagcgcgacgccgtgcctatcacggagatcggcagc
cagtgcaagctgacgttcaagatgcccggcattacctcgttcgatctggccgcctgcgtc
acctcgcccagcaacgtcaccgaggatgccgagatccaggagatcgaggacggcctctac
tcggtgcactttgtgcccaaggagctgggcgtgcacaccgtctcggtgcgctactccgag
atgcacatacccggctcccccttccagttcactgtcggtcccctgcgcgactccggcagc
catttggtgaaggccggaggctccggcctggagcgcggcgtcgtcggggaggcagccgag
ttcaatgtgtggacccgcgaggcgggcggtggctctctggccatctccgtggagggtccc
agcaaggcagacatcgagttcaaggatcgcaaggacggcagctgcgatgtctcgtacaag
gtcaccgagccgggagagtaccgcgttgggcttaagttcaacgatcgccacatacccgac
tcccccttcaaggtgtacgtctctcctgatgcgggggatgcccacaagctcgaggtgcag
cacttcccgcagggtaacatccaggcggatgccccctaccagtttatggtacgcaagaac
ggagccaagggcgatctggatgccagaattgtggcgccatccggcaccgacgacgattgc
ttcatccaggcgatcgacagcgagatgacctcggtgcgcttctatccacgcgagaacggt
atccatgccatccacgtcaagttcaacggcgtccacatacccgactcccccttcagaatc
aaggtcggcaagaatgtggctgacccagcagctgtccatgccaccggcaacggcctggaa
gaggtcaagactggacacaaggccgatttcattatcaacacctgcaacgccggcgttggc
acgctccacgtctccatcgatggcccctccaaggtggccatggactgcacagaggtcgag
gagggctacaaggtccgctacactcccctgctgcccggcgagcactacatcacggtcaaa
tacaacaacgtgcatattgttggatcgccattcaaggtggatgccgttggcgataagctg
gccgacgagggtgcccaggagacgtcgaccgtcatcctcgagactgtgcagaaggtggcc
aagggtggcaagaacaccggcgtccatctgcccaacttcaagtccgatgccagcaaggtg
gtgcccaagggcatgggcctgaaccgggcctacattggcaagcagaatcagtttagcatc
tgtgccaccgatgcgggaaacaacatcttgtacgtcggcatgtacggaccgaagggaccc
tgcgaggagttccacgtcaagcatgctggccacaacaactacaatgtgcagtatctggtg
cgcgatcgcggacaatatgtgctgctgatcaaatggggcgaggagcatatacccggctcc
ccattccagatcgatgtctag

DBGET integrated database retrieval system