KEGG   Drosophila persimilis: Dper_GL27314Help
Entry
Dper_GL27314      CDS       T01063                                 

Definition
GL27314 gene product from transcript GL27314-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dpe  Drosophila persimilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dper_GL27314
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dper_GL27314
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dper_GL27314
Lipid biosynthesis proteins [BR:dpe01004]
 Desaturase
  First
   Dper_GL27314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 380 aa AA seqDB search
MPPNAVGLPDTLSKVPVDSDLTKETNMEDESSKQTGVLFEGDVETADGALATDTFLFKKA
EDRQLQWVWRNILLFAYVHFAALYGGYLMLAKAKYATVLFSAALYVVGMLGITGGAHRLW
AHRSYKAKWPMRLILIIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVG
WLLCKKHPDVVAKGKGLDLSDLRADPILMFQKKHYYVLMPLACFILPTVIPFYFWNESLL
CSWFVSTMFRWCFQLNMTWLVNSAAHKFGGRPYDQTINPSQNATVSAVTFGEGWHNYHHV
FPWDYKTAEWGNYNLNMTTAFIDLFAKIGWAYDLKSVAPDTIERRVKRTGDGTHELWGWG
DKDLTAEDARDVLFVDKKSE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaatgccgtaggactaccggacacgttatcaaaggtgcccgtcgattccgat
ctgacaaaggagacaaatatggaggacgagtcatccaagcagaccggcgtgctctttgaa
ggcgatgtggagacagccgatggagccctagccacggataccttcctctttaaaaaggcc
gaggaccgccagttgcagtgggtctggcgtaacatacttttgtttgcttacgttcatttt
gcggctctatatggtggatatttgatgctggccaaggctaaatatgccaccgtgctattc
tctgccgccctgtacgttgttgggatgctgggcataacaggaggtgcacatcgtctctgg
gcccatcgatcctacaaggccaagtggccgatgcgtttgatattgatcatcttcaatacg
attgccttccaagacgccgcctatcactgggcgcgcgatcatcgtgtgcatcacaagtac
tcggagacggatgccgatccgcacaatgccacccgtggcttcttcttttcgcacgtgggc
tggttgctctgcaagaagcatcccgatgtggtggccaagggcaaaggcctggacttgtcc
gatttgcgtgccgatcccattctgatgttccagaagaagcactactatgttttaatgccg
ttggcctgcttcattttgcccaccgtcattcccttctacttttggaatgagtcgctgctg
tgctcctggttcgtgtccaccatgttccgttggtgcttccagctgaatatgacctggctg
gtgaacagtgcggcccacaaattcggtggtcgtccgtacgaccagaccatcaatccatcg
cagaatgccactgtttcggcagtcacctttggcgagggctggcacaactaccatcatgtg
tttccatgggactacaaaactgctgaatggggaaactataacctgaacatgacgactgcc
tttattgatctatttgccaagatcggctgggcctatgatctgaaatccgtagcacccgac
accattgaaaggcgtgtgaagcgcactggcgacggcacccacgagctgtggggatggggc
gacaaggatctcaccgcggaagatgccagagatgtgctctttgttgataaaaagtcagag
taa

DBGET integrated database retrieval system