KEGG   Drosophila persimilis: Dper_GL27370Help
Entry
Dper_GL27370      CDS       T01063                                 

Definition
(RefSeq) GL27370 gene product from transcript GL27370-RB
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 465 aa AA seqDB search
MLRRIRAVPIVVITLVGFTLEVLSWIRIAVTRDDVWWTKHSGNCMFVETRKGYPAPNRKF
LTFNHKYETPPGLSDALQGNTDGPSTPHSCGFRHNLCGVQHLRRYYTRQQLRILVPRSIL
ESGPAFPIAFLWTYPVDVFPKGLASVNKDSQIFDRPPRLDGGPYNLLSGSFNHSPAWKCV
VCLWLAAAKLLVKEESDYKAHGLGKDNADNNQLQEMDLEQELVLVPAPGQLPRPAVQEGA
VTTETVHLYDAASLRQSRFNPFNPTRILIHGWLGNANANIYSALLPPYLSLDKGRYNIFT
VDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGLRFEDLQLVGFSMGAHVAGLAGK
HLQTGRLRMIRALDPALPFFRYAQDKERLAKGDADYVEVLHTSVGSYGFDRPLGHADFYA
NWGSQQPGCFWLECSHWRAFILFAESLRPGREYPARGCASANGSS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtcgcattagggcagtacccattgtagtgatcacattggttggatttaccctg
gaagtactgtcctggattcgcatagccgttacccgggatgatgtgtggtggaccaagcac
tcgggaaattgcatgtttgtggagacccgcaaagggtatcccgcgcccaatcgcaagttc
ttgacattcaatcataaatatgagactccacctggactgagtgatgccctgcagggaaat
acggatggtccttcgactcctcacagttgcggcttccgccataacttgtgcggtgtacag
catctgcgacgttactacactcgtcagcagcttcggatactggtgcccagaagcatcctg
gagagtggtcccgcgttcccgatagccttcctgtggacgtaccctgtggacgtgttccct
aaaggtctggcgagtgtcaataaggactcccagatatttgatcgccctccgagactggat
ggtggaccctacaacctgctttctggcagtttcaaccactctccggcttggaagtgtgtg
gtttgtttgtggctggctgcagcaaaactactcgtaaaagaggagtctgattacaaagcc
catggactggggaaggacaatgcagacaacaatcaattgcaggagatggatctggagcaa
gagctggtgctggtgccggcaccgggacagctgccaagacccgcagtgcaagaaggggcc
gtgaccacggagaccgtgcatctctatgatgccgcctcgctgcggcagtcgcgcttcaat
cccttcaatccgacacgcatcctcatccacggctggctgggcaatgcaaatgccaatatc
tacagcgccttgctcccaccatacctatcgctggacaaggggcggtacaacatcttcacc
gtggactggggccgcggcgccatagcggactacattacggccagctatcgggtgaagccc
gtgggacaggtgctggccaaattcgtggactttctgcaccaggaggcgggcctgaggttc
gaggatctgcagctggtgggcttcagcatgggagcccatgtggcgggcctggctgggaag
cacctgcagacggggcggctcaggatgatccgtgctttggatccggccttgccctttttc
cggtatgcccaggacaaggagcgtctggccaaaggggatgcggactatgtggaggtgcta
catacgagtgtcggcagctacggcttcgatcgcccgctggggcatgccgatttctacgcc
aattggggcagtcagcagccgggctgcttctggctcgagtgcagccactggagggcattc
atcctctttgccgagagtctgcggcccggccgggaatatccggcccgtggctgtgcgtca
gcgaatggcagcagttga

DBGET integrated database retrieval system