KEGG   Desulfovibrio piezophilus: BN4_10157Help
Entry
BN4_10157         CDS       T02481                                 

Gene name
phoA
Definition
alkaline phosphatase PhoA (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpi  Desulfovibrio piezophilus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN4_10157 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN4_10157 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN4_10157 (phoA)
Enzymes [BR:dpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BN4_10157 (phoA)
Exosome [BR:dpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN4_10157 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161629..163137
Genome map
AA seq 502 aa AA seqDB search
MNVHGKRIMELGVFLVLCGLSLLGGCSQEPVSVRAEDTVEKTAKYVFLFIGDGMGLPQRA
ATAAYTGKKLVIDTFPAQGVTTTFANDRFITGSAASATALASGIKTNINYIGVDENFKPV
RTVAEIAKEQGKKVGIVSSVSIDHATPAAFYAHVKTRKMYHEIDYALAESGFDYFAGGGL
KDPTGKKSESPLGDALSRAKHNGYTIVRNKADFKSLTPADGKVLAWNEWLQDGQALPYVM
DMTDADITLPEFTAKGIELLDNETGFFMMVEGGKIDWACHANDATASILNTIAFDNAVSQ
AVDFYDRHPDETLIVVTGDHECGGLTLGFAGTKYGSYFQILGNQKVSFQKFTDEILVAFK
EKGGSFDDMKSLVTKEFGLKFAGDPKVDPTVLEGFQIDELKMAFNRSMSDSPKAKGAEYL
LYGEYDPLAVTLTHVLNQKAGLGWTSYKHTGVPVSTSALGVGSELFNGSYDNTDIAKKIM
IVMGVPAKPQYVDAERLELAVK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcatgggaaaagaattatggaattaggggtgttcttggttctttgtggactg
agcttattggggggatgctctcaggaacctgtctctgttcgggcagaggacacagtggag
aaaacagcaaaatacgtttttctgtttatcggtgatgggatggggcttcctcagcgagca
gccacagctgcatataccgggaaaaaattggtcattgatactttcccggctcagggtgtg
acaacgacatttgcaaatgaccgattcataaccggttcagctgcatccgcaaccgcctta
gcgtcgggtatcaagacaaacatcaattatattggtgtggatgagaactttaagcctgtg
agaactgtggcagaaatagcgaaggaacaggggaagaaagttggcattgtttcaagtgtc
tccatagatcatgctactccggccgcgttttatgcgcatgtcaaaacccgaaagatgtat
catgaaattgattatgccttggcagagtccggtttcgattatttcgcaggtggagggctt
aaggacccgaccggcaagaaatccgagtccccgttgggagatgctttgtccagagcaaaa
cataacggatatacaatcgttcgcaacaaagctgatttcaaatcgctgactccagccgat
gggaaagtgctcgcctggaatgaatggctgcaggatgggcaggcgcttccctatgttatg
gatatgaccgatgccgatatcactttacctgagtttactgccaagggcatcgaattgctt
gataatgaaacaggctttttcatgatggtcgaaggtggaaagattgattgggcatgtcac
gcgaacgatgccactgcttctattctcaataccatcgcatttgataatgccgtcagccaa
gctgttgatttttatgatagacacccggacgaaacccttatcgttgtgacaggtgaccat
gaatgtggcggattgactcttggattcgccgggaccaaatatggttcatatttccagata
ttgggaaatcagaaagtatcctttcagaaatttactgatgagatcctcgtggcattcaag
gagaagggtggttcttttgatgatatgaaatcgctggtaaccaaggaattcggcctcaag
ttcgcaggggatcccaaggtcgacccaactgtcctggaaggttttcagatcgacgaactc
aaaatggcgttcaatcgtagtatgtctgattctccaaaagcaaagggggccgagtacctt
ctttatggagaatatgatcccttggcagtaaccttgacccacgtactcaaccaaaaagcg
ggccttggctggacttcttacaagcacaccggagtgcctgtatccacttcggcgttaggt
gttggttcggagttgttcaatggaagttatgacaataccgatattgccaagaaaatcatg
attgtcatgggtgtgcctgccaagccccagtatgtcgatgccgagcgtcttgaattggca
gtgaaataa

DBGET integrated database retrieval system