KEGG   Desulfovibrio piezophilus: BN4_11935Help
Entry
BN4_11935         CDS       T02481                                 

Definition
Uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dpi  Desulfovibrio piezophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031340..2032845)
Genome map
AA seq 501 aa AA seqDB search
MANVFLVGAGPGDPGMVTLRAKEIIETCDIMIYDYLANVDFLKWCKAECEILYVGKKGGD
HTLPQEKINELIIEKARSGKIICRLKGGDPYVFGRGGEEGEELVEAGIDFEVVPGITAGV
AAPAYAGIPVTHRDHTTSVCFITGHEDPTKSESGNNWAVYGQSNSTLVFYMGVGNLPMIA
KNLMENGRDAETPVALVRWGTRCNQTSFVSTLENVAEEAEKRQWKAPSIIIVGGVCSLHD
KLAWFEKKALLGKGVIVTRAREQASGLVNILQGHGACVHEFPTISVEHLDDYNEVETAIL
QLARYQWVVFTSVNGVKFFWEQLAAIGLDSRIFGGMQIAAIGPATAEELKARGIIPDFVP
EKYVAEHVVEGLLERGIQGQDVLIPRARVAREVLPEELKKVGCNVTVLPVYETKLVQASS
KEIEDAMDKGAINYVTFTSSSTVENFFELVNPDVFRQYPEIKIASIGPVTTKTLERFGFT
PSIEPEDYTIPGLVDALLMDA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtttttctcgtcggagctggaccgggtgatccgggtatggtgactcttcgt
gccaaggagatcattgagacctgcgatatcatgatctacgattatctggccaatgtcgat
tttctgaagtggtgcaaggcagagtgcgaaatcctgtacgtgggcaaaaaggggggagac
cacaccctgccccaggaaaagatcaacgaactgatcatagagaaagcccgtagcggcaag
atcatctgtcgtttgaaaggtggcgatccgtacgtgttcggtcgtggcggcgaagagggt
gaggagttggtggaggccggtatcgatttcgaggttgtgccgggcatcactgccggagtt
gctgcaccagcctatgccggtattccagtgacacaccgcgatcacacgacttcagtctgt
ttcatcaccggccacgaagacccgaccaaaagcgagtccgggaataattgggccgtgtac
ggacaatccaattccacactggttttttacatgggtgtgggcaatctgcccatgattgcc
aaaaatctgatggagaatgggcgggatgccgaaactccggtggcattggtccgatgggga
acccggtgcaaccagacttcctttgtctctacgttggaaaatgtggcggaagaggcggag
aagcggcagtggaaagcaccgtccatcattatcgtgggcggagtctgctccctgcatgac
aaactggcatggttcgaaaaaaaagcattgctgggcaagggagtcattgtgacccgtgca
cgggaacaggccagcggattggtgaatatcctgcagggacatggtgcatgtgtccatgag
ttcccgaccatttcggtggagcatctcgatgattacaacgaggtcgagaccgcaatttta
cagttggcccggtatcagtgggtggtgtttacttcggttaatggggtcaagttcttctgg
gaacagttggccgctatcggactggattcccgaatcttcggtggcatgcagattgcggct
attggcccagctacagctgaagagttgaaggctcgcggtatcattccggactttgtcccc
gagaaatatgtggctgagcatgtcgtggaaggcctgcttgagcgcggtatccagggacag
gatgtcctgatcccgagagccagggtcgctcgggaagtactgcctgaagaattgaagaag
gtcgggtgcaacgtgactgtcctgcccgtctacgagaccaaattggttcaggccagcagc
aaggagattgaggacgccatggacaagggcgcgatcaattatgtaaccttcacgtcgtca
tcgacagtagagaacttcttcgagttggtgaatccggacgttttccggcaatacccggag
atcaaaatcgcttccatcggtcctgttacgacgaagaccctggagcggttcggttttact
ccgagcattgagcctgaagattatactatacccggattagtggatgcattgctgatggat
gcatga

DBGET integrated database retrieval system