KEGG   Danaus plexippus (monarch butterfly): KGM_201647Help
Entry
KGM_201647        CDS       T04344                                 

Definition
(GenBank) hypothetical protein
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpl  Danaus plexippus (monarch butterfly)
Brite
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     KGM_201647
Peptidases [BR:dpl01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   KGM_201647
Exosome [BR:dpl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   KGM_201647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 717 aa AA seqDB search
MLGIIICVPLYAIAALVLGASITVGIFVFHVAVVPLIFKYSKTFRRHLIFANFAQWPLNV
NYDSPAESGIEGARNLYIEYQSKVDKCPMKIGVWHILPKSSYERVKGSFECGDNEELNRA
MDEDIISSKHPIILYCHGNSNSRAAYHRIQLYKFFQKMDFHTIAFDYRGYGDSTNVMPTE
DGVVEDSLIVYDWLNTTLEPAKDRPPVIVWGHSLGTGISSHLLGNLKELSKNILQKVEPL
KLPNGLILESPFNNLADEVNHHPLAVLVSWLPYFKEMFVSPFVGCPCHSFRSDEHLARET
SLPVLVLHARDDLVVPHVVGEKLYQSIVKSRVNGGATIKLHSYDKNQNLGHKWICNAKDL
PEVVGAILLTGASLTASVLVLQVAVLPLLFRYSKSVQRKMVFSNCINYPKNLDFENPQSC
NLVGGRNFNIVFESVVDNCTIKLGVWHIVPCSLFRELFVVHDYLSIDQRLLNELRKTRNT
VVLYCHGNSNHRASPHRLQMYKVFQDLNFHVITFDYRGYGDSTHVRPTEGGVVEDALQVY
NWIMNNVRQNEQPTVVLWGHSLGTAIAANLVSNLDGLCSSRGVCLPPPNALVLEAPFNNL
LDEIECHPFSKLVSWLPYFRGSFVKPFMSSEHTFTTDCYLSRVPSLPILMLHSRGDRIVP
YDLACKLHECIMTSRSKGGAPLVFHSFDRGHNDLCEDPDLPAVVANFLELVKKKRNM
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaattatcatctgcgtgcctttatatgcaattgcggccttagtactgggtgcc
tctataactgtaggtattttcgtattccacgtggccgtggtacctttaatattcaaatat
tctaaaaccttcagacgacatcttatattcgctaactttgcacaatggcctctaaacgtc
aattatgacagcccagcggagagcggcatagagggagcgaggaacctttatatcgaatac
cagtcaaaagtagataaatgtcccatgaaaataggtgtatggcatatactgccgaagagt
tcgtatgagagagtcaaaggtagttttgaatgtggagacaacgaggagctgaaccgagcg
atggatgaagatattattagctctaaacatcccattatattatattgtcacggcaactcc
aacagcagagcggcctaccacaggatacagttgtacaaattcttccagaaaatggatttt
catactatagcatttgattacagaggctacggtgattcgactaacgtgatgccgactgaa
gatggcgtggtggaagattctctaatcgtatatgattggttgaacacaacgttagagccg
gccaaggacagaccgcctgttattgtatggggacattcacttggtactggcatctcatca
catttgctcggtaatttgaaagaactgtccaagaatattctacagaaagttgaacctttg
aaactgcctaatggtttaatattggagtcaccgttcaataatttggcagacgaggtcaat
caccatccactggccgtgctggtctcatggctgccttacttcaaagagatgtttgtttct
ccgttcgtgggctgcccctgtcattcgtttcgctctgacgaacatctagcccgagagaca
tccctgcccgtgttggtgttgcacgctagagacgatttagtcgtacctcacgtagtcgga
gaaaagctctatcagtcaatagtcaagtcacgtgtcaacggcggggcgacgataaaacta
cattcctatgacaagaaccaaaatcttggacacaaatggatctgcaacgcgaaggatctg
ccggaagttgtcggagctatacttttaaccggcgcgtcgcttacggccagtgtactagtc
ttacaggtggctgtattgcctctcctttttaggtatagcaagtcggtacaaaggaaaatg
gtgttttctaattgcattaattatccaaaaaatttggatttcgaaaacccacaaagctgt
aatttagttgggggaagaaattttaacattgtgttcgaatcagtggttgacaactgtaca
atcaaactaggcgtatggcacattgtcccctgctccttattccgggaactgttcgttgtg
catgactacctctcaatagaccagcgactgttgaacgagctcaggaagactagaaacaca
gtagtgttgtattgtcatggtaactcgaaccaccgagcgtcaccacaccgtctccagatg
tacaaggtgttccaggacctgaacttccacgtcatcacgtttgattacagaggttacgga
gactcgacccacgtccgtccgaccgagggcggcgtggtcgaagacgccctccaggtgtac
aactggatcatgaacaacgtccggcagaacgagcagccaacggtcgtgttgtggggtcac
tcgctgggaacagctatagctgctaacctggtctccaacctggacggcctgtgtagttcc
cggggggtgtgtcttccgccgccgaacgcgctcgtcctggaggcgcctttcaacaacctc
ctcgacgagatcgaatgccatccgttctcgaagctggtctcctggctgccgtacttccgc
ggctcgttcgtgaagccgttcatgtcttcggagcacaccttcactacagactgctacttg
tcccgcgtcccctcgctgcccatactgatgctacactcgcggggagacaggatcgtgcct
tacgacctcgcttgtaagctccacgagtgcataatgacctcgaggtcaaagggcggcgct
ccactggtgttccactcgttcgaccggggacacaacgacctctgcgaggaccccgacctg
cccgcagtcgttgcgaattttttggaactcgtcaagaagaagagaaatatgtga

DBGET integrated database retrieval system