KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10020Help
Entry
Dpse_GA10020      CDS       T01032                                 

Definition
GA10020 gene product from transcript GA10020-RA (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Module
cGMP signaling
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dpse_GA10020
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dpse_GA10020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 1502 aa AA seqDB search
MRFCFDRLCFATKRPATNNNRQSSSHSTNEPHTTTDAAAAAATATATPSTAPPQKQQQIH
QQPIGKGGDLFYAEYQKLKPAIVHRDYRDKPPDIEPENEEKLPQKETPPAPQSPKKSQTP
SIQTEIQRTELQIQQLQSEIQQTHLQLRRYRRHSSAEDRRKPKQQHHTNHTKVLSPDSDF
VSDSAGDPKIRKAASMQQEPNANYQFQTDLGLVSIVQNVANNAANTNNAYAATSNNNNNN
NNLLGGGVGIVTLPSAGNNLGLLGLEQTASGLRLIQAPPPHSDVLTHTLIYGTPPSGAQQ
LHTDPRSLLHQQELQLQQRYQQLQQLQAQTQGLFSYHQPSPRGNPGASQPVAIPGAATVA
SCNSPTQLQAQPLPLSHPSTLALAQVQQQMQGLRISGGCGAPSPGSATPSPVGMGEPTLM
MSNTAAYVAATPQEERFIQIIQAKDLKIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSR
SSAAGAGGSSGGGSGPSTATGATRKSGQTFQRQRAQGISAEPQSESSVLLEHVTFRKYDK
NERSRELIKSAILDNDFMKNLDLSQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEAV
DASLSLEGSSAMGAIYEANWLQAAAPLPLPHHPPGGGGGGTTTLSRQGSSAGTSFLLDGI
SALSKYQMTLENIRKLEQQSRDRRRIVSIKELNGYRPSALQHHQQQQLENNWVTEDQDQE
EEPQKEECPAPGPNPKQKIPEHIEEPAVNHYVLDPTERPRVPRPRQQLSVKPPSLRRSQT
MAMPPSYATMRSPRKQAKAAATASNSSSSAYSTFSSAAEDLRDPAEQVVICQQPQLPQLR
APKEQPSLPQRVAKPLSRSQTSVQRYATIRMPHHSTSFCRAAARSTDPSAVRRHSLEQAL
QGLQVQEEQPRPRVAEPRQISPTASSNGSSKDLNGEGFCIPRPRLIVPVHTYARRRRTGN
LKEQSSAGQEEEPAKDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAISECNL
WAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKDLADDTLIKISDVLEETHYQRGDYIV
RQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICDS
PEGVSCLVIDRETFNQLISNLDEIKHRYDDEGALERIKINEEFRDINLTDLRVIATLGVG
GFGRVELVQTNGDTSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFK
DKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPEN
LLLNDRGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMF
ELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGG
ISEIQKHKWFDGFYWWGLQNCTLEPPIMPTVKSVVDTTNFDDYPPDPEGPPADDVSGWDK
DF
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgttttgataggctgtgcttcgcaaccaagcggccagccacaaacaacaat
cgccaaagcagcagccacagcacaaatgaaccacacaccaccacagatgcagcagcagca
gcagcaacagcaacagcaactccatcaacagcaccaccgcagaaacagcaacagatacac
cagcaaccgatcggaaagggaggagatctattctatgcggaatatcagaaattaaagcca
gcgatagttcatagggattacagggataaaccaccggatatagagccagaaaacgaggag
aagcttccccaaaaggagaccccaccggcaccacaatctcccaagaaatcccagacacct
tccatacaaacagagatacagcggacagagctacagatacaacagctacagtcagagata
caacagacacatctacagctgcgtcgctatcgccgtcacagcagtgccgaagatcgtagg
aaaccgaagcagcagcaccacacgaaccacacgaaggtactatcaccagattccgatttc
gtttccgattccgccggcgatccgaagatccgtaaagcagccagcatgcagcaggagccg
aacgccaactatcagttccaaaccgacttgggtctggtgagcatcgtccagaacgtcgcc
aacaacgccgcgaacaccaacaacgcttacgccgcgacaagcaacaacaacaacaataat
aataatctgctgggcggcggcgtcggcatcgtgacattgccctccgcgggtaataacctt
ggacttttgggcctcgaacagacggcgtcgggtctacggctgatacaagccccaccgccg
cactccgatgtactcacccacacgctgatctacggcacaccgccgtcgggggcacagcag
ctgcacacggaccccaggagtctgttgcatcaacaggagctgcagctgcagcagcgctat
cagcagttgcaacagctccaggcccagacgcagggactcttctcgtaccaccagccgagt
ccgagaggtaatccgggagcaagtcagccggtggcaatacccggagcggcaaccgttgct
tcctgcaactcgcccacgcagctgcaggcgcagccgctgccactgtctcatccctcaacg
ctggccttggcgcaggtgcagcaacagatgcagggtctccggatatccgggggctgtggc
gcccccagtcccggctcggccaccccctcaccggtgggcatgggagagccgacgctgatg
atgagcaacacggccgcctacgtggctgccacgccgcaggaggagcgcttcatacagatc
atccaggccaaggatctcaagatccaggaaatgcagcgtgccctccagttcaaggacaac
gaaatagcggagcttaaatcccatctggataaattccagagcgtcttccccttcagccgg
agcagtgccgccggtgcgggcggatcctcgggcggcggtagtggccccagcactgccaca
ggtgccacccgcaagtccggacagaccttccagcgacagcgtgcccagggtatatccgca
gagcctcaaagtgaatcctcggtgctgctggagcatgtcacatttcgcaaatacgacaag
aatgagcgctcccgtgaacttatcaagtctgccattctggataatgatttcatgaagaat
ctggatctgtcgcagatacgagaaatcgtcgattgcatgtatcccgttaagtatccagcc
aagaatctaattatcaaagagggagatgtgggcagcattgtttatgttatggaagccgtg
gatgccagcctctcgctggagggcagcagtgccatgggtgccatctatgaagccaattgg
ttgcaggcagcggcaccacttccacttccacaccatcccccaggtggaggtggaggaggc
acaacgaccctcagtcgacagggaagcagtgcgggtaccagctttctcctggatggaatc
tcagcgttgagcaaataccaaatgactctggagaatatccggaaattggaacagcagtca
agggacagacggaggattgtgagcatcaaggagctgaatggctatcgaccttcggcgctg
cagcatcaccagcagcaacaattggagaacaattgggtgacagaggatcaggatcaggaa
gaggagcctcaaaaggaggagtgtcccgcacccggtcccaatcccaagcaaaagatcccg
gaacacatagaagaacctgctgtcaatcattatgtcctcgatcccacagagcggccgcgt
gtgccacgcccacggcagcaattgtcggtgaaaccgccttcgctgcgacgatcccagacc
atggccatgcctccgagctatgcaacgatgagatcgccacgaaagcaggcaaaagctgca
gccacagccagcaacagtagttcctccgcgtactctacgttctcctccgctgcggaggat
ctaagggatcctgcagagcaagtggtgatatgccagcagccgcagctgccgcagctacgt
gccccgaaggagcagccatcactgccacaacgtgtcgccaagcccctgagcagatcacag
accagtgtccagcgctatgccaccattcgcatgccccaccactccacctccttctgtcga
gcggctgcccgatccacagatccatcggcagtgcggaggcacagcctggagcaggccctg
cagggactccaggttcaggaggaacagcctcgtccgagggtggcggagccgcgacaaatc
tcacccactgcctcaagcaatggcagctccaaggatctcaatggggagggtttctgcata
ccccgacctcgtctcatcgttcccgttcacacatatgcacgtcgtcgtcgcacagggaat
ctcaaggagcagtcgagtgccgggcaagaggaggaaccagcgaaggatggacgcgtggag
gtctcacgcgagggcaaatacctctcgaccctctccggagcgaaggtccttggggagctg
gcgatcctgtacaattgccagaggactgccacgattacggccatcagcgaatgcaatctg
tgggccatcgagcggcagtgcttccagaccatcatgatgcgcacggggctcattcgtcag
gcggaatacacggatttcctcaagagtgtacccattttcaaagatcttgcggatgatact
ctcatcaaaatctccgatgtcctggaggagacgcactatcagcgtggcgactacattgtg
cgccagggggcacgcggcgacaccttcttcatcatctccaagggcaaagtgcgggtgacg
atcaagcaacaggatacccaggaggagaaattcattcgaatgttggggaagggcgatttc
tttggcgagaaggcgcttcagggggatgatctacgcacagccaacattatttgtgattcc
cccgagggcgtgagttgtctggtgattgatcgcgagaccttcaatcagctgatctccaat
ttggacgaaatcaagcatcgatatgacgatgaaggagccctggaacgcatcaaaatcaat
gaggaattccgggacataaatctcacagatttgcgtgtgattgccaccctaggagtgggt
ggttttggacgcgtggaactcgtgcagaccaatggcgatacgtcgcgctcgtttgccctc
aaacagatgaagaaatcacagattgtggagacacgccagcagcagcacatcatgtccgag
aaggagatcatgggcgaggccaattgccagtttattgtgaagctcttcaagaccttcaag
gataaaaagtatctgtacatgctgatggagagctgtctcggtggagagctctggaccata
ctgcgggacaagggaaactttgatgatagcacaacgagattctacaccgcctgtgtggtg
gaggcctttgactatctgcactcgcggaatataatctacagggacctgaagccggagaat
ctgctgctgaatgatcgcggctatgtgaagctggtggactttggttttgccaagaagctg
cagacgggtcgcaagacctggacgttctgcggaacgcccgaatacgtggcccccgaggtg
atactgaatcgtggccacgacataagtgcggactattggtcgttgggtgtcctaatgttt
gagctgttgacgggtacccctccgtttacgggctccgatcccatgcgcacctacaacatc
atacttaagggcatcgatgccatcgaattccccaggaatatcacacgaaatgccagcaat
ctgatcaagaagctatgtcgtgataatcccgccgaacgtttgggctatcagcgtggcggc
atcagcgagatacaaaagcacaaatggttcgatggcttctactggtggggccttcaaaat
tgcacactggagccaccgatcatgccaacagtcaagagtgtggtggataccacaaacttc
gatgactatccacccgatccggagggtccacccgcagatgatgtcagtggatgggataag
gatttctag

DBGET integrated database retrieval system