KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10037Help
Entry
Dpse_GA10037      CDS       T01032                                 

Definition
GA10037 gene product from transcript GA10037-RA
Orthology
K14764  
protein SHQ1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 642 aa AA seqDB search
MLYGQITHSYKENTCTLVIPHPHAREKPSHSPTAAEAAAKGAPAEAEAAEAETGRGVVDA
LAQGGTGCAEALHVDRIRNCDIFVDSHDLYFYADVKLYKFHSRRTFDLRELKTLLIKFNP
EDNHYQLCLRCLPPATAATTQDSSSGGGASSSIGDAPKPKTVRKEYIATFLRLPTLADAL
YQPEKESLVQEWKLKRITDQCQLQLEGNERIYKLTNHFGYGYASKYSGPPDISLVDKSTC
RVLEPHRLSPIQRLQDRIVVEMKRFSRDQYKMNFVELQVPSGHQNPLRFKPKIFETSMTQ
EQAHLLHNLSREALQKQQKDEEPGDEDSPLERLRQKEIDCGLISIVLAICYDVRTTNNDP
TCESAWTRSILCPLFCYYEQFDNYRDVLVAFLRRAITYPLFRNFELGRQCVRDAIEVLKG
GRNWLINQLLLTHQQFASGEPCRESYNTYYLEDYIRYVTNANVCSDEHLRLLARNVKNVL
MDVTKKHLNLGVTEIETELIQELMQEMRLTAGGESPLLQQGGGGDDEMDMDNDTSGQEDE
TTTDDDSVITDSFDSMDMDMRLIENEAVYAANDDNDNDDDDDDDEDDDEDEDDDEEGDAD
DDNEDSASSTTTSSEPEGNSVIEQCSNSETAASNSISTTSTK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgttatatggacagatcacacacagctataaggagaacacatgcacccttgtgataccg
catccccatgccagggagaagccgtcgcactcgcccacagcagcagaagcagctgcaaag
ggagcaccagcagaggctgaagcagcagaagcagagactgggcgcggggtcgtggatgcc
ttggcacaggggggtacggggtgtgcggaagcattacatgtggatcgcataagaaactgc
gatatatttgttgactcgcatgatttgtacttttatgccgatgtcaagctgtacaaattc
cacagccgacgcacattcgatttgcgagagctgaaaacactgctgataaaattcaatcca
gaggataatcattaccagctatgcctacgctgcctgccgcctgccactgcggccaccact
caagatagttcatcaggaggtggagcctcctctagcattggcgatgccccgaaaccaaag
accgtgcgcaaggagtacattgccacctttttgcggctgcctacactggccgatgccctg
tatcagccagagaaggagtcccttgtccaggaatggaaactcaaacgcatcaccgatcag
tgccaactgcagctcgagggaaacgagcgcatatacaagttaacaaatcatttcggctat
ggctatgccagcaaatacagtggacccccggatattagccttgtggataaatccacttgt
cgtgtgttggagccccatcgccttagccccattcagcgtctgcaggatcgtattgttgtc
gaaatgaaacgcttttcacgcgaccaatacaaaatgaactttgtggagctgcaggttccg
tccgggcatcagaatcccctgcgcttcaagcccaaaatctttgaaacttccatgacccaa
gagcaggcccatctgttgcataatctcagtcgagaggcgttgcagaaacagcagaaggat
gaggagcccggagatgaagatagccccttggagaggctcagacaaaaagagatcgactgc
ggcctcatcagcattgtgctggccatttgctacgatgtgcggaccaccaataacgatccc
acctgcgaatcggcctggacgcgcagcatactgtgtcctctattctgctactacgagcag
ttcgacaactacagggatgtcctggtggccttccttcgtcgtgccataacctatccactg
ttccgcaactttgagctcgggcgccagtgcgttcgggatgccatcgaggtgctaaaaggc
ggtcggaactggctgattaatcagcttttgttgacgcaccagcagtttgccagcggtgag
ccgtgccgcgagagctataacacctactacctggaggactacatacgctatgtgaccaat
gcgaatgtctgcagcgatgagcatctgcgtttgctggctcgcaatgtgaagaatgtgctg
atggatgtgaccaaaaagcatctgaatctgggcgtcaccgaaatagagactgaactgatc
caggagctgatgcaggagatgcgtctgactgccggcggggagtcgccgttgctgcagcaa
ggagggggtggcgatgatgagatggatatggacaacgacacgtccggccaggaggatgag
acaacgactgatgatgacagtgtcataaccgattcattcgatagtatggacatggacatg
cgtttgattgagaatgaggcggtctatgcggcgaacgacgacaacgataacgacgacgac
gacgatgatgatgaagacgatgatgaggacgaggatgatgatgaagagggcgatgcggac
gatgataatgaggattctgcctcatcaacgacaaccagcagcgagccggagggcaacagc
gtcatcgagcagtgcagcaacagcgagacggccgccagcaatagcatcagcaccaccagc
accaagtag

DBGET integrated database retrieval system