KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10136Help
Entry
Dpse_GA10136      CDS       T01032                                 

Definition
GA10136 gene product from transcript GA10136-RA (EC:3.6.1.3)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA10136
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     Dpse_GA10136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1309 aa AA seqDB search
MDEASGTTTTDGKSLDEAPVAAGLEPTQPIGFLQLFRFSTCGEIAWLFFGFLMCCVKALT
LPAVVIIYSEFTSMLVDRAMEFGTSSKVHALPLFGGGKSLTNATLAVRNEALYDDSISYG
LLLTIASVVMFIAGIFSVDIFNVVALRQVSRMRIMLFTSVMRQEIGWHDLASKQNFVQSM
VDDVEKIRDGISEKVGHFVYLIVGFIITVAISFSYGWKLTLAVSSYIPIVILVNYYVAKF
QGKLTAREQESYAGAGNLAEEILSAIRTVVSFGGEKAEVQRYENFLVPARKASQWKGAFS
GLSDALLKSMLYLSCAGAFWYGVNLIIDDRGVEDKEYTPAILMIAFFGIIVGADNIARTA
PFLESFATARGCATNLFKVIDLQSKIDPLSTDGKLLNYGLRGDVEFQDVFFRYPSRPEVT
VHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVMLDDLDIRKYNIQWLRS
NIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHEFITGLPESYRTMIGERG
SQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSHR
LSAIRGADKIVFIQDGKVLEEGSHDDLMALESAYYRMVRAGDIHMPDELQTEDEETTIDD
AKRKSLALLEKSFETSPLNFEKGAHKENSVQFDEPIVKPLPKDSNALKLQDAATAAEKPN
FFHTFARIVRLSRPEWCYLVLGTISAIAVGCLYPAFSIIFGEFYAALAEQDPEDALSRTA
VLSWACLGLAFVTGLVCFLQTYLFNYAGIWLTTRMRAMTFKAMVSQEVGWFDDEDNSVGA
LSARLSGEAAGVQGAIGYPLSGMIQALSNFTSSVTVAMYYNWKLALLCLANCPIIVGSVI
LEAKMMSTAIVREKQVIEEACRIATESITNIRTVAGLRREADVIRQYTQEIHRVEGLIHQ
KLRWRGVLNSTMQASAFFAYAVALCYGGVLVSEGQLPFQDIIKVSETLLYGSMMLAQSLA
FTPAFSAALVAGHRLFQILDRRPRIVSPMGTIRNTLAKQLNLFEGVRYRGIEFRYPTRPD
AKILQGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGSIHIDHDDIQHDLTLEG
VRSRLGIVSQEPTLFERSIAENIAYGDNRRSVSMAEVMAAAKSANAHSFIISLPNGYDTR
MGARGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDSACSGRTCI
VIAHRLSTVQNADCICVVQNGRVVEQGTHLELISQRGIYAKLHKTQKDH
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggcttccggcacgacgacaaccgatggcaagtccctggatgaggcgccggta
gccgcaggactggagcccacacagccgatcggcttcctgcagctcttccgcttctccacc
tgcggggagatcgcgtggctcttctttgggttcctcatgtgctgcgtcaaggcgttgacc
ctgcccgcagtggtcatcatttacagcgagttcacgtcgatgctggtggaccgggccatg
gagttcgggacgagctcgaaggtccacgcgttgcccctcttcgggggcggaaagtcgctc
acaaacgccactctggcggtgaggaatgaggccctctacgacgactccatctcgtacggc
ctgctgctgaccatcgcatcggtggtgatgttcatagctggcatcttctcggtggacatc
ttcaacgtggtggccctgcggcaggtctcgcgcatgcggatcatgctcttcacctcggtg
atgcggcaggagattggctggcacgacctggcgagcaagcagaacttcgtccagagcatg
gtcgatgacgtggagaagatacgcgacggcatctccgagaaggtgggacacttcgtctat
ctgattgtgggcttcatcatcacggtggccatatccttcagctacggctggaagctcacg
ctcgccgtcagctcctacattcccatcgtgatcctcgtgaattattatgtggcaaagttt
caaggaaaactcacggccagagagcaggaatcgtatgcgggggcgggaaacctcgccgag
gagatcctcagtgccattcgcacggtcgtgtcctttggcggggagaaggcggaggtgcag
cgctacgagaacttcctggtgcccgcgcggaaggccagccagtggaagggcgccttctcg
ggcctcagcgacgccctgctcaagtccatgctgtacctgtcgtgtgcgggcgccttctgg
tacggcgtcaacctgatcatcgacgaccgcggagtggaggacaaggagtacactcctgcc
atcctgatgatcgccttcttcggcatcattgtgggggcggacaacatcgcccggacagcg
cccttcctcgagtccttcgccaccgcccgtgggtgtgccaccaacctcttcaaggtcatt
gacctccagtccaagatcgatcccctctcgacggatggaaagctcctcaactacggcctg
cggggcgacgtggagttccaggatgtcttcttccggtatccctcccgccccgaggtcacc
gtccatcggggcctgaacatcaggatccgcgcggggcaaacggtggctctggtgggctcc
tccggctgtggcaagtccacgtgcgtgcagcttctgcagaggttctacgatcccgtcttc
ggttccgtgatgctcgacgacctggacatccgcaagtacaacatccagtggctgcgctcc
aacatcgcggtggtgggccaggagccggtgctcttcctgggaaccattgcccaaaacatc
agctacggcaagccgggggccacccagaaggagatcgaggcagctgccacccaggcgggg
gcccacgaattcatcacgggactgccagagagctatcgcacaatgatcggggagcgggga
tcccagctgtcgggcggacagaagcagcgcattgccatcgcccgggcactcatccaaaac
cccaaaatcctgctgctggacgaagcaacgtccgccctggactaccaatcggagaagcag
gtgcaacaggccctggatctggccagcaagggacgcaccaccattgtggtgtcgcatcgt
ctgtccgccattcgcggggccgacaagattgtcttcatccaggacggcaaggtcctcgag
gagggctcgcacgacgacctgatggccctggagtccgcatactaccgaatggtgcgtgcc
ggggacatccacatgcccgacgagctgcaaacggaggacgaagagacgaccatcgatgac
gccaaacgcaaaagcctggcactcctcgagaagtccttcgagacgagtcctttgaacttt
gaaaagggtgcccacaaggagaacagcgtgcagttcgacgagcccatcgtgaagcccctc
ccgaaggacagcaacgcactcaagctgcaggacgctgccaccgccgcagagaagcccaat
ttcttccacaccttcgcgcggatcgtgcggctctcccgccccgaatggtgttacctggtc
ctcgggacaatcagtgccattgccgtcggctgcctctacccggcgttctccatcattttc
ggtgaattctacgccgcactcgcggaacaggacccggaggacgccctcagccgcaccgca
gtcctctcgtgggcgtgcctgggcctcgccttcgtcacgggactcgtgtgcttcctgcag
acgtatctgttcaactacgcgggcatttggctgacgacccgaatgagggccatgaccttc
aaggcgatggtcagccaggaggtcgggtggttcgacgacgaggacaactccgtgggcgcc
ctgtccgcccgtctctcgggggaggcagcgggcgtgcagggtgccatcgggtatcccctg
agcggcatgatccaggccctctccaacttcacttcgagcgtcaccgtcgccatgtactac
aactggaagctggcgctcctctgcctcgccaattgtccgataatcgtcggttcagtcatc
ctggaagccaagatgatgtccaccgccatcgtgagggagaaacaagtcatcgaggaggcc
tgtcgcattgccaccgaatccatcactaacatccgcactgtggcggggctccggcgggag
gcggacgtcattcggcagtacacgcaggagatccatcgggtggagggcctcatccaccag
aagctgcgctggcggggcgtcctcaactccacgatgcaggcgtccgcgttcttcgcctac
gcggtggccctctgctacggcggcgtcctggtctccgagggacagctgcccttccaggac
atcatcaaggtctcggaaaccctgctctatggctccatgatgctcgcccagtcgctggcc
ttcacccccgccttctcggcggccctcgtggccgggcaccgcctcttccagatcctcgac
cgcaggcccaggatcgtctcgcccatgggcaccatccggaacaccctcgccaagcaactg
aatctctttgagggcgtgcgctaccgcggcattgagttccgctatccgacgcgacccgat
gccaagattctccagggcctggatctggaggtgctcaagggccaaacggtggccctggtg
gggcactccggctgcggcaagtccacctgcgtgcagctgctgcaacgctactacgacccg
gatgagggatccatccacatcgaccacgatgatatccagcacgatctgaccctcgagggc
gtacgctcccgcctcggcatcgtctcgcaggagcccaccctcttcgagcgctccatcgcg
gagaacatcgcctacggggacaaccgacgctccgtctcgatggccgaggtgatggccgcc
gccaagagcgccaatgcccacagcttcatcatctcgctgccgaacggctacgacacgcgg
atgggggcccgcggcacccagctgtcgggcgggcagaagcagcgcatcgccatcgcccgg
gccctggtgcggaaccccaagatcctgctcctggacgaggccacctcggccctggacctg
cagagcgagcagctggtgcagcaggccctcgactccgcgtgcagcggacgcacatgcatt
gtcatcgcccaccgcctgtccaccgtccagaacgccgactgcatctgcgtggtgcagaac
ggccgcgtggtggagcagggcacccacctggagctcatttcccagcgcggcatctacgcg
aagctccacaaaacccagaaggatcactga

DBGET integrated database retrieval system