KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10136Help
Entry
Dpse_GA10136      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:3.6.3.44]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Dpse_GA10136
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     Dpse_GA10136
Transporters [BR:dpo02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    Dpse_GA10136
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA10136
CD molecules [BR:dpo04090]
 Proteins
  Dpse_GA10136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 RsgA_GTPase ABC_ATPase Zeta_toxin AAA_29 G-alpha DUF815 AAA_33 ATP-synt_ab Rad17
Motif
Other DBs
NCBI-GeneID: 4814152
NCBI-ProteinID: XP_001354221
FlyBase: FBgn0070195
UniProt: Q29FI1
Position
XR
AA seq 1309 aa AA seqDB search
MDEASGTTTTDGKSLDEAPVAAGLEPTQPIGFLQLFRFSTCGEIAWLFFGFLMCCVKALT
LPAVVIIYSEFTSMLVDRAMEFGTSSKVHALPLFGGGKSLTNATLAVRNEALYDDSISYG
LLLTIASVVMFIAGIFSVDIFNVVALRQVSRMRIMLFTSVMRQEIGWHDLASKQNFVQSM
VDDVEKIRDGISEKVGHFVYLIVGFIITVAISFSYGWKLTLAVSSYIPIVILVNYYVAKF
QGKLTAREQESYAGAGNLAEEILSAIRTVVSFGGEKAEVQRYENFLVPARKASQWKGAFS
GLSDALLKSMLYLSCAGAFWYGVNLIIDDRGVEDKEYTPAILMIAFFGIIVGADNIARTA
PFLESFATARGCATNLFKVIDLQSKIDPLSTDGKLLNYGLRGDVEFQDVFFRYPSRPEVT
VHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVMLDDLDIRKYNIQWLRS
NIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHEFITGLPESYRTMIGERG
SQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSHR
LSAIRGADKIVFIQDGKVLEEGSHDDLMALESAYYRMVRAGDIHMPDELQTEDEETTIDD
AKRKSLALLEKSFETSPLNFEKGAHKENSVQFDEPIVKPLPKDSNALKLQDAATAAEKPN
FFHTFARIVRLSRPEWCYLVLGTISAIAVGCLYPAFSIIFGEFYAALAEQDPEDALSRTA
VLSWACLGLAFVTGLVCFLQTYLFNYAGIWLTTRMRAMTFKAMVSQEVGWFDDEDNSVGA
LSARLSGEAAGVQGAIGYPLSGMIQALSNFTSSVTVAMYYNWKLALLCLANCPIIVGSVI
LEAKMMSTAIVREKQVIEEACRIATESITNIRTVAGLRREADVIRQYTQEIHRVEGLIHQ
KLRWRGVLNSTMQASAFFAYAVALCYGGVLVSEGQLPFQDIIKVSETLLYGSMMLAQSLA
FTPAFSAALVAGHRLFQILDRRPRIVSPMGTIRNTLAKQLNLFEGVRYRGIEFRYPTRPD
AKILQGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGSIHIDHDDIQHDLTLEG
VRSRLGIVSQEPTLFERSIAENIAYGDNRRSVSMAEVMAAAKSANAHSFIISLPNGYDTR
MGARGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDSACSGRTCI
VIAHRLSTVQNADCICVVQNGRVVEQGTHLELISQRGIYAKLHKTQKDH
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggcttccggcacgacgacaaccgatggcaagtccctggatgaggcgccggta
gccgcaggactggagcccacacagccgatcggcttcctgcagctcttccgcttctccacc
tgcggggagatcgcgtggctcttctttgggttcctcatgtgctgcgtcaaggcgttgacc
ctgcccgcagtggtcatcatttacagcgagttcacgtcgatgctggtggaccgggccatg
gagttcgggacgagctcgaaggtccacgcgttgcccctcttcgggggcggaaagtcgctc
acaaacgccactctggcggtgaggaatgaggccctctacgacgactccatctcgtacggc
ctgctgctgaccatcgcatcggtggtgatgttcatagctggcatcttctcggtggacatc
ttcaacgtggtggccctgcggcaggtctcgcgcatgcggatcatgctcttcacctcggtg
atgcggcaggagattggctggcacgacctggcgagcaagcagaacttcgtccagagcatg
gtcgatgacgtggagaagatacgcgacggcatctccgagaaggtgggacacttcgtctat
ctgattgtgggcttcatcatcacggtggccatatccttcagctacggctggaagctcacg
ctcgccgtcagctcctacattcccatcgtgatcctcgtgaattattatgtggcaaagttt
caaggaaaactcacggccagagagcaggaatcgtatgcgggggcgggaaacctcgccgag
gagatcctcagtgccattcgcacggtcgtgtcctttggcggggagaaggcggaggtgcag
cgctacgagaacttcctggtgcccgcgcggaaggccagccagtggaagggcgccttctcg
ggcctcagcgacgccctgctcaagtccatgctgtacctgtcgtgtgcgggcgccttctgg
tacggcgtcaacctgatcatcgacgaccgcggagtggaggacaaggagtacactcctgcc
atcctgatgatcgccttcttcggcatcattgtgggggcggacaacatcgcccggacagcg
cccttcctcgagtccttcgccaccgcccgtgggtgtgccaccaacctcttcaaggtcatt
gacctccagtccaagatcgatcccctctcgacggatggaaagctcctcaactacggcctg
cggggcgacgtggagttccaggatgtcttcttccggtatccctcccgccccgaggtcacc
gtccatcggggcctgaacatcaggatccgcgcggggcaaacggtggctctggtgggctcc
tccggctgtggcaagtccacgtgcgtgcagcttctgcagaggttctacgatcccgtcttc
ggttccgtgatgctcgacgacctggacatccgcaagtacaacatccagtggctgcgctcc
aacatcgcggtggtgggccaggagccggtgctcttcctgggaaccattgcccaaaacatc
agctacggcaagccgggggccacccagaaggagatcgaggcagctgccacccaggcgggg
gcccacgaattcatcacgggactgccagagagctatcgcacaatgatcggggagcgggga
tcccagctgtcgggcggacagaagcagcgcattgccatcgcccgggcactcatccaaaac
cccaaaatcctgctgctggacgaagcaacgtccgccctggactaccaatcggagaagcag
gtgcaacaggccctggatctggccagcaagggacgcaccaccattgtggtgtcgcatcgt
ctgtccgccattcgcggggccgacaagattgtcttcatccaggacggcaaggtcctcgag
gagggctcgcacgacgacctgatggccctggagtccgcatactaccgaatggtgcgtgcc
ggggacatccacatgcccgacgagctgcaaacggaggacgaagagacgaccatcgatgac
gccaaacgcaaaagcctggcactcctcgagaagtccttcgagacgagtcctttgaacttt
gaaaagggtgcccacaaggagaacagcgtgcagttcgacgagcccatcgtgaagcccctc
ccgaaggacagcaacgcactcaagctgcaggacgctgccaccgccgcagagaagcccaat
ttcttccacaccttcgcgcggatcgtgcggctctcccgccccgaatggtgttacctggtc
ctcgggacaatcagtgccattgccgtcggctgcctctacccggcgttctccatcattttc
ggtgaattctacgccgcactcgcggaacaggacccggaggacgccctcagccgcaccgca
gtcctctcgtgggcgtgcctgggcctcgccttcgtcacgggactcgtgtgcttcctgcag
acgtatctgttcaactacgcgggcatttggctgacgacccgaatgagggccatgaccttc
aaggcgatggtcagccaggaggtcgggtggttcgacgacgaggacaactccgtgggcgcc
ctgtccgcccgtctctcgggggaggcagcgggcgtgcagggtgccatcgggtatcccctg
agcggcatgatccaggccctctccaacttcacttcgagcgtcaccgtcgccatgtactac
aactggaagctggcgctcctctgcctcgccaattgtccgataatcgtcggttcagtcatc
ctggaagccaagatgatgtccaccgccatcgtgagggagaaacaagtcatcgaggaggcc
tgtcgcattgccaccgaatccatcactaacatccgcactgtggcggggctccggcgggag
gcggacgtcattcggcagtacacgcaggagatccatcgggtggagggcctcatccaccag
aagctgcgctggcggggcgtcctcaactccacgatgcaggcgtccgcgttcttcgcctac
gcggtggccctctgctacggcggcgtcctggtctccgagggacagctgcccttccaggac
atcatcaaggtctcggaaaccctgctctatggctccatgatgctcgcccagtcgctggcc
ttcacccccgccttctcggcggccctcgtggccgggcaccgcctcttccagatcctcgac
cgcaggcccaggatcgtctcgcccatgggcaccatccggaacaccctcgccaagcaactg
aatctctttgagggcgtgcgctaccgcggcattgagttccgctatccgacgcgacccgat
gccaagattctccagggcctggatctggaggtgctcaagggccaaacggtggccctggtg
gggcactccggctgcggcaagtccacctgcgtgcagctgctgcaacgctactacgacccg
gatgagggatccatccacatcgaccacgatgatatccagcacgatctgaccctcgagggc
gtacgctcccgcctcggcatcgtctcgcaggagcccaccctcttcgagcgctccatcgcg
gagaacatcgcctacggggacaaccgacgctccgtctcgatggccgaggtgatggccgcc
gccaagagcgccaatgcccacagcttcatcatctcgctgccgaacggctacgacacgcgg
atgggggcccgcggcacccagctgtcgggcgggcagaagcagcgcatcgccatcgcccgg
gccctggtgcggaaccccaagatcctgctcctggacgaggccacctcggccctggacctg
cagagcgagcagctggtgcagcaggccctcgactccgcgtgcagcggacgcacatgcatt
gtcatcgcccaccgcctgtccaccgtccagaacgccgactgcatctgcgtggtgcagaac
ggccgcgtggtggagcagggcacccacctggagctcatttcccagcgcggcatctacgcg
aagctccacaaaacccagaaggatcactga

DBGET integrated database retrieval system