KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10250Help
Entry
Dpse_GA10250      CDS       T01032                                 

Definition
GA10250 gene product from transcript GA10250-RA (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA10250
Enzymes [BR:dpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dpse_GA10250
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA10250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 327 aa AA seqDB search
MDRKLHSGMHHPTLRLLQESGCEISPHNLMYPVFIVSNDDDVQPIASMPGISRFGVNRLR
DHLEPLVKKGLTSVLLFGVVESELKDEEASNADSAVNPVVRALPKLREWFPDLLIACDVC
ICPYSSHGHCGLLGKAGLENGPSIKRIAEIAIAYGQAGAHIVAPSDMMDNRVRAIKQALI
DASLNSVSLLAYSAKFASNFYGPFREAAQSAPKFGDRRCYQLPSGSRSLAMRAIQRDVSE
GADMLMVKPGMPYLDILRQTKDSYPYHTLYVYQVSGEYAMLYHASKAGAFELRDAVLESM
RSFRRAGADCIITYYTPYLLDIIGRTA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaccggaaactacacagtggcatgcaccatcccaccctgcgactgctgcaggagtcg
ggctgtgaaatctcgcctcacaacctgatgtaccccgtcttcattgtgagcaacgacgac
gatgtgcagccgatcgccagcatgccagggatctccaggttcggagtgaaccgactgcgg
gatcacctggagccgctggtcaagaagggactgacctccgtgctactcttcggcgtggta
gaatctgaactgaaggacgaggaggcctcgaatgcggactcggcggtgaaccctgtggtg
cgggccctgcccaagctgcgggaatggtttcccgacctgctcattgcctgtgacgtctgc
atctgtccctattcctcgcacggccactgcggcctcctgggcaaggcaggcctggagaac
ggaccgagcataaagcggatagccgagatagctatagcgtacggacaggctggggcccac
atcgtggctccctccgacatgatggacaaccgcgtgcgggccatcaagcaggccctgatc
gacgccagcttgaacagtgtctcgctgctggcctattccgccaagttcgcgtccaacttc
tacggtccgttccgggaggcggctcagtcggcccccaagttcggcgatcggcggtgctac
cagctgcccagtggatcccgcagcctggccatgcgcgcaattcagcgcgatgtcagcgag
ggggcggacatgctgatggtgaagcccggcatgccgtacttggacattctgcgacagacc
aaggactcctatccctaccacacactgtacgtgtaccaggtgtccggcgaatacgccatg
ctctatcacgcctctaaggcaggtgccttcgagctgcgcgatgccgtgctggagtccatg
cgaagcttccgtcgcgctggggccgattgcatcattacctactacaccccctacctgctg
gacataattggcaggaccgcctaa

DBGET integrated database retrieval system