KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10281Help
Entry
Dpse_GA10281      CDS       T01032                                 

Definition
GA10281 gene product from transcript GA10281-RA (EC:3.1.3.- 3.1.3.48)
Orthology
K14165  
atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 200 aa AA seqDB search
MEMSAAMFARVSFYPTLLYNVLMEKASARNWYDRIDDTVILGALPFRTQANDLIQKENMK
AVVSMNEDYELTAFSNNSDKWRKLNVEFLQLATTDIFESPNQDKLFRGVEFINKFLPQSN
RISGLSSTQSPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDEAVDHMRACRPHILL
HTKQWDALRLFYTNNVQAKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagtgctgctatgttcgcacgtgtgtccttctaccccaccctgctctacaat
gtcctgatggagaaagcttccgccaggaattggtacgaccgcattgacgacactgtcata
ctgggagcactcccctttcggactcaagccaatgacttgattcagaaagagaacatgaag
gcggtggtgtccatgaacgaggactacgagctgacagccttctcgaacaattctgataaa
tggcggaaacttaacgtcgagttcctacagctggccaccaccgatatcttcgagtcgccc
aaccaggacaagctcttccgcggcgtagagttcatcaataagttcctgcctcagtcaaat
cgcatcagcgggctgagctccacgcagtcaccagagaatgttggctctgtctatgtacac
tgcaaggcaggcagaacgcgcagtgccaccttggtcggatgttatctgatgatgaaaaat
ggatggaccccagacgaagctgtagatcacatgcgtgcgtgtcgtccgcatattttactg
cacaccaaacaatgggacgccctcagattattctacacaaataatgtgcaagcaaagtca
tga

DBGET integrated database retrieval system