KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10332Help
Entry
Dpse_GA10332      CDS       T01032                                 

Definition
GA10332 gene product from transcript GA10332-RA (EC:5.-.-.-)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpo00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 364 aa AA seqDB search
MVHVTEDVFATGAVNPFTKQTEPIRRFTLCNGGRMSVQVITLGATITSIKTEDARGQLDD
VTLGFDDLEGYQSEKNPYFGATIGRVCNRVANGRFRLDGEVVEVSKNRDNKFQLHGGFVG
FDKAHWDVVSVRQDGVTLSHTNPDGHEGYPGKVTATVNFTLSEDNCLHVRMMAESDKPTP
VNLTNHSYFNLAGHKAGANGLYEHTIEINAYGITETDKDSIPTGKITLVDGTFFDLRVPN
NLGERLKQLQPARGYDDNFCVEFDPPQPFSKVARATHPPSGRWLEVVSNQPGVQFYTANF
MPDVERGEAAIPGKSGAAYAKHGAFCLETQKFPDSVNHSNFPSTTLRPGGTYNHEVIYKF
GVSQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgtcaccgaggatgtttttgctactggagcagtcaatccatttaccaagcaa
acggaacccattcgacgctttacgctatgcaatggcggtcgcatgtcggtccaggtgatc
accctgggcgccaccatcaccagcatcaagacggaggatgcccgcggccagctggacgac
gtcacgctaggatttgacgacttggagggttatcagagcgaaaagaatccctactttggc
gccaccattggacgtgtgtgcaatcgtgtggctaacggacgcttcaggctggatggcgag
gtggtggaggtgtccaagaaccgggataacaaattccagttgcatggcggattcgtgggc
ttcgacaaggcccactgggatgtggtttcggtgcgtcaagacggcgtcacactatcgcac
accaatcccgatggccatgaaggttatccgggcaaggtcacggccacagtgaactttacc
ctcagtgaggacaactgcctgcatgtccggatgatggcggagagtgacaaacccacgccc
gtgaatctcacaaaccactcgtacttcaacctggctggccacaaggcgggtgccaacggt
ctctacgagcacaccatcgagatcaatgcctatggcatcaccgaaacggacaaggactcc
atacccaccggtaagatcacactggtggacggaacttttttcgatctgcgcgtgcccaac
aatctcggcgagcgcctcaagcagctgcaaccggcccgcggctatgatgacaatttctgt
gtggagtttgatccgccacagcccttctctaaagtggccagagcaacgcatccacccagt
ggacgctggctggaggtggtcagcaatcagccaggcgttcagttttatacggccaacttt
atgccggacgtggagcgtggagaggcggccattcccggtaagagtggagcagcctatgcc
aagcatggagccttctgcctggagacccaaaagtttcccgattctgtgaatcacagcaac
ttcccatcgacgaccttgcgccccggcgggacctacaaccacgaagtcatctacaagttt
ggcgtctcccaataa

DBGET integrated database retrieval system