KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10855Help
Entry
Dpse_GA10855      CDS       T01032                                 

Definition
GA10855 gene product from transcript GA10855-RA (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dpse_GA10855
   00330 Arginine and proline metabolism
    Dpse_GA10855
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dpse_GA10855
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dpse_GA10855
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dpse_GA10855
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dpse_GA10855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 342 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHYQKECNGIPVKVTIISEEFSPNTTGDGSAGLWGPYLL
GGTEKSKVYKWSKNMHSFLEQIWLSEDAGEAGVCLVPCIRLSTSTVDTVEDFWRDIVYGA
LDLTAEQLAVYNQGRSVKFTSGLSFVTYTSEPVKLLPYLMKRFARNGGAVVQQKVTDLER
FITESPYDVIVNCSGLGSRELLNDDQMYAVRGQVSRVKANWMFSAVLDESDDGNYIIPNT
ESVVLGGTHQERDYNTRVCEKDKKLIVDGCRQFVPGLCHTKPLFDWVGLRPGRANLRLEA
ERRGQKLLIHNYGHGGSGVTLCWGCADDVLDLLLAAKNISKL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacatcgctgttatcggggctggcgtcaacggtgtcgccagtgccataaagatc
ttggagcactaccagaaggagtgtaatggcatccctgtgaaggtgacgatcatctcggag
gaattctcgccaaacaccacaggagatggctcggcgggtctttggggcccttatctgctg
ggtggcacggaaaaatctaaagtctacaagtggtcgaagaatatgcatagttttctggag
cagatctggctaagcgaggatgccggcgaagctggtgtttgtctagtgccctgcatccgt
ctgagcacatctacagtggatacagtcgaggatttctggcgtgacattgtttatggggct
ctggacctaaccgctgaacagcttgcagtctacaatcaaggcagatcggtgaagtttaca
tctggtctgtcctttgtcacatacacctcagagcccgtgaaactactgccgtatctcatg
aagcgtttcgctcggaacggaggtgcagtagtgcagcaaaaggtcacagatctggagaga
ttcatcactgaatcgccctacgatgtgattgtcaactgttcaggtctgggctcccgcgaa
ctgctcaacgatgatcagatgtatgccgtgcgcggtcaggtttcccgagtgaaagccaat
tggatgttctcagccgtactggatgagagcgatgatggcaactatataatacccaacact
gagagtgtcgtactgggcggcacccaccaggagagggactacaacaccagggtctgcgag
aaggacaagaaacttattgtggacggctgtcgtcagtttgttccgggcctgtgccacacc
aagccgctgttcgattgggtaggcctccgcccaggacgtgcaaatttgcgcctcgaggcc
gagcggcgtggccagaagctgctcatccacaactatggacacggcggcagtggggtgacg
ctgtgctggggctgtgccgatgatgttctcgatctcctgctggctgccaagaatatttca
aagttgtaa

DBGET integrated database retrieval system