KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10893Help
Entry
Dpse_GA10893      CDS       T01032                                 

Definition
GA10893 gene product from transcript GA10893-RA (EC:2.3.1.-)
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA10893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 2440 aa AA seqDB search
MMRESAHDISMETWIQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAV
DSGAVIKVYNKGLHSYKAPMAKRRVKVDKNTNLYKLVAKAVHDLGECEGSTLKSIENYIQ
KFNCIDLSPNVDFKTVIKASIKKAVDAGFLIQEGKLYKKGKSLTTPRKCVPQTDVVIKGE
DTCTHCSGNSQKNLNGIPEPLSSCKQCGISLHTTCANIAGRCKSQSYVLLYMLVTKGTLW
DCQSCADCAVCKMRNRGPCLLQCFVCKDHFHLTCLDTIPDKKPKHPYRCKTCSKQSIENP
KLLKKDATKIKSEAGNEKLSSYDRVAFSKRQIIKREGNAESPSTSKLCVYNDGNGQRRKL
SGSGLNARKLNISEDQFEFPSKQRKSQILQGGYIASQETRKRTFSDLSSSSSSSDSEDDD
DEDDDRNRNDNDQDESTSSDSCTSSSSDSDSSESSSDSSECDDENDDEDYDTDRSTLKGK
LFENVKQNNCKLNAGGASERLSSPETNEAANENWGFAAVAKNPIDIFVKSKNNGGAKGIN
YTKQMVETGGYGAAAAASASLIVRAPKGTGPMATHASTADKDSKSSGNLQRKKIVPLKSM
PLDAGKSYEKCEDEEDIPYLTEETVLKCQMMEQIDRCRDTKSEGKTNPESEDMCAENMKR
TNPFENQPLPPCVNPVDVDLYQEVLHKAVVQMSNNCQKMTDVAQQKQGQHTLSPKSIQIG
KWDIETWYSSPFPQEYARLIKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGN
ISVFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKE
KHCTQKYNVSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYW
KSVVLEYLYKYRNQPKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKI
DWKKVLSHNNRMAHSKTRILIEADCLRWSPLLSVSKLPNIIKPISNREYLSNQLMQKSEY
KEKEFPEDTKVEAKQSITSSKPIPAISGDENIKSRSGERLEEQRENPRKRRSSEELSKLA
TSVGKKIKLALEQEAVADDHSFGDNSDSSDCKSPKNASELSEHLTKRAQRLAKRNDLIPH
TNKRKHFERQLENNAHDQSLSLGQSQSEPETTPAVQPALDAGSALEEPPSKEVCRNQAEK
AEHTDKPVNIVPKLRGKQSNGKRSEESQFTEATDSLAAPAPASDPASAPAPALGTEKSMK
TTNTEVVAKAFETEKSEAEGNSSISEQVLDAVAKKTKKTVFADVTSYNMNSEIEVKYSAT
QKPTENAIEPGKGANVKEHKILQLETPVPPPAVAAASAAPELKSPVTSSSPLEKKEEVPP
PVAPQQQPAQPLAVQEKSANPVCMAEEKKPNLDMSCLKPESSVFTELLPPVQPAGAVAVA
VAHEKTKEIAPQMIPEVQVPGPVPVPVLQKPMEVKKVDVVVPTHPSPANAANGNANQRPE
PAHSYVDPPKPLPNQHIQAQPQPQAQAQPQAFNEPHNQGHNDQLKTKDNGDIKEKPIKCK
PVQETPVVKPEVHQAYATERKFDSAKMKAVPEREAVKPDHQVVQVKEEDRSNSRGPPASA
PSNVVPVVREKLQLKGIPEHTQLQNPIPSQFNINQMPNYHHTSQYWQWDYYSYNLHLDSA
TQKGQKQFQKDLATTMAYTHNLTQNLYQSANHLAMHHAATHHQIHQTKEKHKLERKNTGK
KEEHPKLLSGGNVASTSREDAAHGHSSCNEYGVNNQAAIYNQKCAPQQKMFKPSPEQAQQ
MKSLANAQNAVPRQGNPNANPNPNQAESSALVPNSVNPQAGGTVAAKQKLEHGVNSASVI
TREGKIKIGHPNIHAAPQHSNLQVPGQSEVNPNMVYSPEASANVGMQQQQQQQQQQHYDC
GINAQINMESPANIGSAINHGSDNIQTAASNVHMHQPHRQYSDCSMQNQPATTPMHMSIQ
NSHMQQQNNLNMNLAPEGSPNISLLGNAQQQQQQQQQQQQQHQQHQTRKLNTQADNSNVS
SPTPSHRATTPKQIRSGNAAQQRDAKNSSTSTTTTNAHHQIPQGATSNIPKSHQESLHNL
QFSQHGHQQNMQPLDYVPIPQISQNFSTNPSNYDIVGMPPAVIQQRMSLNSSVHPLANSH
QRIEQPSSACAVNNFYLQNNMPASENAPRVPVSSSLGPPSAGANNNNDQRQATQESISGS
NSSGTGGTSSGSSLAGNLCSLSKLQQLTNCLESQPCNTSPGAQVNLTPSPHHPIPPNSMT
PPPHLLMQNRNISTPPNMLQTQVAPLQYHKYYPGNMNIAPIASTQNPSRNTRNTPSAPVQ
HTSAPISSTNNRTTNVHISPNLMASYGAMNSYRMSPQQSPPTGGYSSGSEYPNSQIPMQM
GVMNMQSQYQDACVLQRATQSNPMYPTYSPYLPLNGTIRR
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggagtcggcacacgatatcagcatggagacgtggatacagtggattctggag
gcgatatccaaaatcagatcccaaaaacagaggccatccgttcagaggatatgccaggcc
atcggcacgcaccacaagttccacgaggacattgtggccgaaaagctggagaaggccgtg
gactcgggagccgtgattaaggtctacaacaagggattgcactcgtacaaagcgcccatg
gccaagcgtcgggtaaaagtggacaagaacaccaacctctacaaactggtagccaaagcg
gtgcacgatctgggcgagtgcgagggatctaccttgaagagcatagagaactatattcag
aaattcaactgcatcgacctctcgcccaatgtcgactttaagaccgtaataaaggcatcc
atcaagaaggccgtggacgccggctttctgatccaggagggtaaactgtacaaaaagggc
aagtccctgaccacgccacgaaagtgtgtcccccagacggatgtggttataaagggggaa
gacacttgcacccattgctccggaaactctcagaaaaacctcaatggcattccagagccc
ctgagctcctgcaagcagtgtggcatctctctgcacaccacatgcgcaaacattgccggc
agatgcaagtcgcagtcgtatgtgctgctctacatgctcgtcaccaagggaaccctgtgg
gactgccagagctgcgccgattgcgctgtctgcaagatgcgcaaccgtggaccctgtctc
ctgcagtgtttcgtctgcaaagaccatttccacctgacttgtctcgacacgatacccgac
aagaagcccaagcatccctacagatgtaagacgtgctcaaagcagagcattgaaaaccca
aaactattaaaaaaagatgccacaaaaatcaaatcggaggctggaaatgaaaagctgtcg
tcgtacgacagagtcgccttcagcaagcgacaaataatcaaaagggagggaaacgccgag
agtccctcaacctcgaaactgtgtgtctacaacgatgggaatggccagagaaggaaacta
tcggggtctgggttgaatgccaggaaactaaacataagtgaggatcaattcgagttcccc
tcgaagcagaggaagtcacaaatactacagggaggctacatcgctagccaagagacgcga
aagcgcacgttttcagatctatcgtcgtcaagctcctccagtgacagcgaggacgacgac
gatgaggacgacgacaggaacaggaacgacaatgatcaggatgagagcaccagctcggat
tcatgcacttcctcgagctcagactcggactcgagcgaaagttccagcgacagttcggaa
tgcgacgacgaaaacgacgacgaagactatgacaccgatcggagcacgctaaagggaaag
ctatttgagaatgttaagcagaacaattgcaagctgaatgccggcggcgccagtgaacgc
ctgagttcgccagaaaccaatgaagcggcgaatgagaattggggattcgcagcggttgcc
aagaatccaattgatatatttgtgaagtccaagaacaatgggggtgccaaaggcattaac
tatactaagcaaatggtagaaacaggaggctatggagcagcagcagcagcatcagcatcg
ttaatcgttagggcaccgaaaggcaccgggccaatggccacacatgcttcgacagcagat
aaggattcaaaatcctctggaaacttgcagaggaaaaagattgtgcccctgaagtcgatg
cccctcgatgctggcaaatcgtacgagaaatgcgaagatgaggaggacattccatacctc
acagaagagactgtattaaagtgtcaaatgatggagcaaatcgatcgttgcagagacaca
aaaagcgaagggaaaaccaatccggaatcggaagatatgtgtgcggaaaacatgaagcgt
accaatccgtttgagaatcagccgctgccgccatgcgttaatccagtggatgttgatctg
tatcaggaagtactccacaaagccgttgtccagatgtccaataactgtcagaagatgacg
gacgtggcccagcagaagcaaggacagcacacgctgagtcccaagtcaattcagatcgga
aagtgggacattgagacatggtactccagcccgttcccgcaggagtatgccaggctcatc
aaactctttctgtgcgaattctgtttgaagtacacgaagagtcggtctgtgctggacagg
caccagaacaagtgcatctggaagcagccgccgggcacggagatatttcgccaggggaat
atctcggtgttcgaggtggatggcaatgtgaataagatatattgccagaacctgtgcctg
ctggccaagttctttctggaccacaagacgctctactacgacgtcgagcccttcctgttc
tatattctaacgaagaacgatcagagcggctgccaccttgttggctacttttcgaaggag
aagcactgcacgcagaagtacaatgtctcctgcatactgaccatgccgcagtatcaaagg
cagggctacggccgattcctaattgacttcagctatctgctgagccgcgaggagggccag
ctgggaacccccgagaagccgctctcggatctggggcgtctctcgtacttttcgtactgg
aaatccgttgtcctcgagtatctgtacaagtatcgcaatcagccgaagatcacgttcaag
gacattgcaatcaaaacgggtctagccatatcggacattgcgctggcattcgaactgctg
aacttcatcaaactgcggaagaacgatggggacattcggtatcagataaacgtgaaaatc
gactggaagaaggttctcagccacaacaataggatggcgcacagcaagacgcgcattctc
atagaggccgactgcctgcgctggagtcccttgctttcagtctctaagttgcccaatatc
atcaagccgatctccaatcgggagtacttgagcaaccagctgatgcagaaatccgagtac
aaagagaaggagttccctgaggacaccaaagtcgaggccaaacaaagtattacctcttcg
aagccgattccagcgatcagcggcgatgagaacatcaaaagccgcagtggggagaggctg
gaagagcagagggaaaacccgcgcaagcgccgttccagcgaggagttgtcgaagctggcc
acgagcgtgggaaagaagattaaactggcgctggagcaggaagcggtggccgacgaccac
tcctttggcgacaactccgactcttcggattgcaagtccccaaagaacgccagcgagctc
tccgagcacttgaccaaacgggcccagagactggccaagcgcaatgatctgattccgcac
acgaacaagcgcaagcatttcgagcggcagctagagaacaatgcacacgatcagagccta
tcgttgggtcagagccagtccgagccagagacaacccctgcggtgcagcctgctctcgac
gctggatctgcattggaagagccaccctccaaggaagtctgcagaaatcaggccgaaaag
gctgaacacactgataagccagtgaatatcgtacccaaactcaggggcaagcagtccaat
gggaagcgatccgaggagtcgcagttcacagaagccacagactcactagcagctccagct
ccagcttcagatccagcttcagctccggccccagcactcggcactgaaaaatcgatgaaa
acaacgaacacagaagtcgttgccaaagcattcgagacggagaagagcgaggccgaaggc
aacagcagcataagcgagcaggttctagatgccgtggctaagaaaactaaaaagaccgta
ttcgcggatgtaacgtcctacaatatgaacagtgagatcgaagtaaagtatagcgcaacg
caaaagccgacagaaaatgcaatcgagccaggaaaaggggccaatgtcaaggaacataaa
atactacagcttgaaactccagttccacctccagctgtagctgcagcttcagctgctcct
gagctgaagagtcctgtcacaagtagcagtcctctggagaaaaaagaagaggttccccct
cctgtggccccacagcagcagcctgctcagcctctagctgttcaggagaagtcggccaat
cccgtctgcatggcagaagaaaagaaaccgaatctggatatgagctgcctgaaaccagag
tcatccgtgttcacagaacttcttccgccggtacagccagcaggggcagtggcagtggca
gtggcgcatgaaaaaaccaaggaaatcgctcctcaaatgatacccgaggtccaggtcccg
ggcccggtaccggtcccagtcctgcagaaaccgatggaagtgaaaaaagtcgatgtggtg
gtccctacacatccatcaccagccaatgctgccaatggcaatgccaatcagcggccagag
cctgcacattcatatgtggatccgccaaagccactgccaaatcagcatatacaggcccag
ccgcagccgcaggcacaggcacagccacaggcattcaatgagccccacaaccagggacat
aatgatcagcttaagaccaaggacaatggggatatcaaggagaagccgattaagtgcaag
ccagtgcaagaaacgcccgtggtaaagcccgaagtccaccaggcatatgccacagaaagg
aagttcgacagtgccaagatgaaggcggttccggaaagggaggcggtgaagccggaccac
caggtggtgcaagtcaaggaggaggacagatcgaactcacgaggaccccccgcttccgct
ccctcgaacgttgtgcccgtggtgcgggagaaactgcagctaaaggggataccagagcac
acgcagctgcagaacccgatccccagccagtttaacataaaccagatgcccaactaccat
cacacctcccagtactggcagtgggactactacagctacaacctgcatttggactcggct
acgcagaagggccagaagcagttccagaaggacctggccacgaccatggcctacacgcac
aacctaactcagaatctgtatcagtccgccaaccacctagccatgcaccacgcagcgacg
caccatcagatccaccagaccaaggagaagcacaagctggagcgaaagaacaccggcaag
aaggaagagcatcccaagctactgtccggcggcaatgtggccagcacttcccgcgaggac
gcagcacatggccacagcagctgcaacgagtatggcgtgaataatcaggctgcgatatac
aatcagaagtgtgcaccgcagcagaagatgttcaagccatcgcccgagcaggcgcagcaa
atgaagtccctggctaatgctcaaaacgcggtgcccagacaaggcaatcccaatgcaaat
ccgaacccaaaccaggccgaatcatcggctctggtaccgaactcggttaatccacaggcg
ggggggacagtggctgccaagcagaagctcgagcacggcgtaaactcggcttcagtcatt
acgcgcgagggtaaaattaaaattggtcatccgaacatacacgcggctcctcaacactcg
aacctgcaagtgcccgggcaatccgaggtcaatccgaacatggtttacagtccggaggcg
tcggcgaatgttggaatgcagcagcaacagcagcagcagcaacagcagcattacgattgc
ggaataaatgcccagataaatatggaatcccccgccaacattggcagcgccattaaccat
ggctccgacaacatccagaccgccgcctcgaatgtgcacatgcatcagccccacaggcag
tactcggactgctccatgcagaaccagccagccaccacccccatgcacatgtccatccag
aactcgcacatgcagcagcagaataacctgaacatgaatctggcccccgagggatcgccg
aacatcagtttgctggggaatgcccagcagcagcagcaacagcagcagcaacagcaacag
cagcatcagcagcatcagactaggaagttgaatacgcaggcggataactctaatgttagt
tctcctacaccgtcgcatcgagccactacgcccaagcaaatacgcagcggaaatgctgcc
cagcagcgtgacgccaaaaattcgtccacgtcaaccacaacgacgaatgcgcatcaccag
attccgcaaggcgccacttcaaatattccaaagtcgcaccaggagtcgttgcacaaccta
cagttctcgcagcacggacatcagcagaatatgcagccgctggactatgtgccaattcca
cagatcagtcagaacttttcgaccaatccctcgaactacgacattgtgggcatgccacct
gcggtcatccagcagagaatgtcgctcaacagttccgtgcatccgctcgcgaacagccat
cagcgcatcgagcagccgtcatcggcatgcgccgtcaacaatttttacttgcaaaacaac
atgcccgccagcgagaatgccccccgggttcctgtgtccagttcgctggggccgccatct
gctggagccaacaacaacaacgaccaaaggcaggccactcaagagtctatatctggatcg
aacagcagtggcactggcggcactagcagcggctcctctctggcgggcaatctgtgcagt
ctctcgaagctgcaacagctcacgaattgcctggagagtcagccatgcaatacgtctccg
ggggcccaagtgaatttaacgccatcgccgcatcacccgattccaccaaactcaatgacc
ccgccccctcacttactgatgcagaacaggaacatttccacgcctcccaacatgctgcag
acgcaggtggcaccactgcagtaccacaagtactatcccggcaacatgaacattgccccg
attgcgtccacgcagaaccccagccggaacacgcggaacacaccgtccgcacccgtgcag
catacctcggcgccaataagtagcacaaacaatcgcaccaccaacgtccacatcagtccc
aatctgatggcctcctacggggcgatgaacagctataggatgtcgccgcagcagtcccca
cccactggcggctacagttcggggagcgagtatcccaactcccagataccgatgcaaatg
ggagtcatgaatatgcaatctcaataccaagatgcttgcgtgttgcagagagccacacaa
tcaaatccgatgtatccaacgtattctccttacttacctctcaacggcaccattcgcagg
taa

DBGET integrated database retrieval system