KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11069Help
Entry
Dpse_GA11069      CDS       T01032                                 

Definition
GA11069 gene product from transcript GA11069-RA (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dpse_GA11069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 679 aa AA seqDB search
MASEQTMEGAAAEAVAAGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSAADNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDISNSLAVFCLATYGEGDPTDNAMEFYEWITNGDVDLSGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDNFGIEGG
GEEVLIRQYRLLEQPDVQPDRIYTGEIARLHSMQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMYPINDKSLVEKLGQLCNADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNVVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRTNKGVATTYLKNKVPNGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESVLYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDS
DKKVYVQHLLEQDADLIWNAIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgagcagacaatggagggagcagccgctgaggccgtggctgccggagacgaa
ccctttctgggactcctcgatgtggcactgcttgcggtcctgattggaggagcagccttt
tactttctgagaagccgcaagaaggaggaggagcccactcgcagctattccatacaaccc
acgacagtatgcaccaccagtgctgccgataattcgttcatcaagaagctcaaggcctcg
ggacgcagtctcgtcgtcttctacggctctcagaccggcactggcgaggagtttgccggc
cgtctggccaaggagggcattcgctatcgtctcaagggcatggttgccgatcccgaggag
tgtgatatggaggagctgctgcagctgaaggacatctccaactccctggctgtgttctgc
ctggccacctacggcgagggcgatcccacggacaatgccatggagttttacgagtggata
acaaatggcgatgtcgatctatctggtcttaattatgcggtctttggactgggaaacaaa
acgtacgagcactacaacaaggtggccatctatgtggacaagcggctggaggaactcggc
gccaaccgggtcttcgaactgggactgggcgatgatgatgccaacattgaggatgacttc
atcacatggaaggatcgcttctggccagccgtttgcgataactttggcattgagggcggc
ggcgaagaggtgctgatacgccagtaccgtctgctggaacagcccgatgtacagcccgat
aggatctacacgggagagattgcccgcctgcactcgatgcagaaccagcggccacccttc
gatgccaagaatcccttcctggcgcccatcaaggtcaatcgtgagctgcacaagggcggc
ggacggtcgtgcatgcacatcgagctgagtatcgacggctccaagatgcgctacgatgcc
ggtgatcatgtggccatgtatcccataaacgacaagagcctcgtggagaagctgggtcag
ctttgcaatgccgatctggatacggtgttctctctgatcaacacagacacggacagcagc
aagaagcatccattcccctgccccaccacctatcgcacggccctgactcactacctggag
atcactgccattccacgcacacacattctcaaggaattggctgaatactgcacagatgag
aaggaaaaggagctgctgcgcagcatggcctccattagtccggagggcaaggaaaagtac
cagagctggatccaggatgcctgtcgcaatgtggtgcatattttggaggatatcaagtcc
tgcaggccgccaatcgatcatgtctgcgagctgctgccgcgcctgcagccacgctactac
tccatctcatcgtcggccaagctgcatccgaccgacgtccatgtcacggctgttctggtc
gagtacaaaacgcccacgggccgtacgaacaagggtgtggccaccacctacctgaagaac
aaggtgccgaacggcagcgaggaggtgaaggtgcccgtcttcatccggaaatcgcagttt
agactgcccacgaagccagagactcctattatcatggtgggaccgggcacgggattggct
cccttccgcggcttcattcaggagcgacagttcctgcgcgatgagggcaagactgtgggc
gagtcggtgctctatttcggctgccgcaagcgcagcgaggactacatctacgagtccgag
ctggaggaatgggtcaagaagggcacgctcaatctcaaggcggccttctcccgagactcc
gataagaaggtctatgtgcagcatctgctggagcaggatgcggatctgatatggaatgcg
attggcgagaacaagggacacttttacatatgcggtgacgccaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccaccaagggtaacatgagcgaggccgacgcc
gtgcagtatatcaagaagatggaggcccagaagcgctactccgccgatgtctggagctaa

DBGET integrated database retrieval system