KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11118Help
Entry
Dpse_GA11118      CDS       T01032                                 

Definition
GA11118 gene product from transcript GA11118-RA (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dpse_GA11118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 141 aa AA seqDB search
MKAFFALVILACAAAPALSGRTLDRCSLAREMSNLGVPRDQLDKWTCIAQHESDYRTWVV
GPANSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQG
WGAWAVWHYCSGWLPSIDECF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttctttgctctggtgatcctggcctgtgccgccgctcccgccctgtccgga
cgcactctggaccgctgctccctggccagggagatgtccaacctgggcgtgccccgtgac
cagctggacaagtggacctgcattgcccagcacgagagcgactaccgcacctgggtggtg
ggacccgccaattccgacggctccaacgactacggaatcttccagatcaacgatctgtac
tggtgccaggccgacggacgcttctcctacaacgagtgcggcctgagctgcaatgccctg
ctgaccgacgacatcaccaactccgtgcgttgcgcccagaaggtcctctcccagcaggga
tggggcgcctgggccgtctggcactactgcagcggatggctgccgtccatcgatgagtgc
ttctaa

DBGET integrated database retrieval system