KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11213Help
Entry
Dpse_GA11213      CDS       T01032                                 

Definition
GA11213 gene product from transcript GA11213-RA (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA11213
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dpse_GA11213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 221 aa AA seqDB search
MISFLFIVNRALSSSSRKMSQGPRPLVLCGPSGSGKSTLLKLLFAEFPNTFGFSVSHTTR
KPREGEKDGVHYYFVERADMEEAIANDEFIETAEFTGNLYGTSKAAVREIQKKGRVCILD
IEQKGVEQIRKTDLNPILIFNNPPTIQELERRLRLRGSETEETLRKRLNAAEVEISYGLT
PGNFHKIINNVDIEAAYTEFRDFVVHELKQQEYDGISISLN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattagctttctgttcattgtaaaccgcgcactcagcagcagcagccgcaaaatgtcg
caaggcccacgtccgcttgtactctgcggcccctccggttccggaaagagcacgctgctc
aagttattgtttgcagagttcccaaacacatttggattcagcgtctcccacaccacgaga
aaaccacgtgagggcgagaaagatggtgttcactattattttgtggagagagccgacatg
gaggaggcgatcgccaatgacgagttcattgagacggccgagttcaccgggaatctatac
ggcaccagcaaggcggccgtacgcgagattcagaagaagggacgcgtctgcatactggac
attgagcagaagggagtggagcagattcggaaaaccgatctcaatcccatactgatcttc
aacaatccgccaaccatccaagagctggagcgtcgactgcgactacgtggctccgagacc
gaggagacgttgcgcaagcgactcaatgccgccgaagtggagatcagctacggcctgacg
ccgggaaacttccacaagatcatcaacaacgtggacatagaggcggcctacacagagttt
cgcgatttcgttgtccatgagttgaagcagcaggagtacgatggcatcagcattagcctc
aattaa

DBGET integrated database retrieval system