KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11290Help
Entry
Dpse_GA11290      CDS       T01032                                 

Definition
(RefSeq) GA11290 gene product from transcript GA11290-RB
  KO
K14310  
nuclear pore complex protein Nup205
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA11290
Messenger RNA biogenesis [BR:dpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dpse_GA11290
Chromosome [BR:dpo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dpse_GA11290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 2090 aa AA seqDB search
MDGMTEDMWTPCKHIYGTLQQAIAQPKDLIGDLEQCLKKNKHSFTNFLRNPPKNEKSRSQ
IRAGLTEGIPLGGQGHKLILSQDLIDEAIILSDMFDLDELIAVELLYTAQRQQMHHPGLP
RGLVAVLLYYDGRKAMACALRDMMQTMSGVSWVIELPREFLSLVNNYVQNLTEESNLLSR
LLDILAEMDVVKENLMLTKNRAFGSTKHQNQVLALYEDIRKAVAMSLFNYSAQRGLPRGN
AIRLMKMLAACKCNDNAGGNMDDVTVIMLMALLYSYDTSVLLISDVVNPYTGRLPIMWDP
EFAKSFHEALYAQAKWQTPRLDAIIKYSFALALASLRQAPSHLQAAASALIPRDEQLMDE
ALASNVFGFIYRQLLENEVIYNTESIYRRAHLLITDFIDFMHAKVAELRNRADESARTVI
SFLNEGLEPPPNLDANFELLMLCVSRLYGDRRANHTLCNEYWGASDTATSAGSGGGSGGG
GGSGSGNNAGLYAMNSSRAVSLFKFISLASELLPQTLFKSYLKMITGLTRTELSARSAFN
LLKNTPSGSSSFSMGWDHFFQALASYYSNMRTDNAFSVMSPGSASNGDLFMRRALQPRNI
TQRETEHLVAVMGIMRAVAEHDRVSRVMMCDQASWQAPQVLLGLVACATPLALKAEIMFT
LAALAKSKETARAIWFQLEDSQIIPTLVVTTTAAGQSPCSLAEEIEQNESRQESYNLSRG
VLQLLHTLMTTHMPRCLGAGPRHPGYDPYFNFLMESIILKVYNRSYKDPSEMWEVAAKGL
KLLFYLLATYRPKASDFMESRDEQPYPGYHVMLQLQVKSHLLQLLLRIIEDARERLDEYR
RFRGKEHLEECALYALLLLEVAVAKQNAFFEAHSSANSPILMSGLDRMLLDINPRTRRPD
YVVKIIKFVTYNNWLPRHSLAAIKILTAVTMLPNVPSQILNMYALGSNEKLEVRQGFVEC
LEMDARLAQQNEELLDSIVLNDYQAMGDVLHHGGHQPPSVAVDEDESEADITGPEDGDTT
LGPCYEVVALNEKMPVGIDLQIKEAVVELFGLNLCQAPPNFVYFLLGIDVLRDFMARDKQ
QVGIEMQCCCVHSLVLVLEKYLESQRHSQEKYCPHTAHLVERVYQLFQGLCANRRSSETI
LRFFRLTCNDFLLRHLSAMPFRRHREDHMLHAMSHLLNCVAVEVRLAANHGQMTRYNLLC
DILLLGGQSDGQRANPGMPQDLNNDILSGTACANFYGLDVGPVAAAVKTPAMPDKTQGLH
ANRLLECLELEVNATAPQPQLEFFDPVLTTAVLKQCEARPRPSPGSGSESGTAAGSEPYL
MINIRKLHDVLHEELRTVQSTIATGQRKAISGEITVLLQYAVEVNRVRTQRIATLRFVDA
WCQLVQILFSSMPDALLPLALRRQYIIDIIEKMLLKVEPVQPLIEISIQITETILLLLAN
LRICYYQLEDQRTSDDCDVTAAQNGDNSLVNGPLSLSYSHAHSQSNISGTMTGSTSNLRF
ILKRIVEWIMVSGAKSQKLRINLYTALLNCLRIVKRLRTEEEVDFHESIASRLEKSQKAV
TDQRHGDKDRLKEMAAEVIGVYGEKLIDSICHDAVTGHDVCRMLALACLEMISELDAVST
LTEFVVSRGYLKHLLDNVAESDDALSAILQPVPDNLRQLYVYEARLAFLTRLSQTGARML
LAEGALGVLSNMRVYDLQPDLKANQLRKDPEGFLPNTSKRFHSILQPALALCDGIVSSLG
SQNDSAAHQVLNFLFAHIDMVETMLRTATPLMDLWHLQQLASITNLFSRTSTPELCTNMA
DSYVQKRDLEFYNRLNRLQQLMIVVFGRFTVTEATIRQILQQEDVESLPESQKSRHVKYF
LDIAANLSLYCRHAVTSHVRDSTTSKFLLTTIVNDVTPLTGRTDGKKLTAIMHTIIEQLK
GSVGYYLSQKSHADNLLEQRSSLPNICFGPSGKESYVELSQRHKEKRNELMQAVFIAEQN
LYLLWIHLDFYMRNAVIFSSENRSAINESNMESSSGNDSVSVLHATPDEILQLKQHLIST
FNETFCSELIVASEEYTVKCKGFNSSLLRRIKALVQFAASNGNANESSFI
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atggatggcatgaccgaggacatgtggacgccatgcaagcatatttatggcacactgcag
caggcgattgcccagccaaaggatctcattggcgatctggagcagtgcctcaagaagaac
aaacatagctttaccaattttctacgcaacccgcccaagaatgagaaaagccgcagtcag
ataagggccggactcacggaaggcataccactgggcggccagggccacaagctgatactg
tctcaggatctgatcgatgaggccatcatattgtcggacatgttcgacctggatgagcta
attgccgtggagctgctgtacacggcccagcggcagcagatgcatcatccggggctgccc
cgtggcctggttgccgttttgctctactatgatggccgcaaggccatggcctgtgccctg
cgcgatatgatgcagacgatgagtggcgtgtcctgggtgatagagctgcccagagagttc
ctttcgttggtgaataattatgtgcagaatctgacggaggaatcgaatttgttgtcccgc
ctgctggatatactcgccgaaatggatgtggtcaaggagaaccttatgctgaccaaaaat
cgcgcctttggctccacaaagcatcagaatcaagtgctggccttgtacgaggacatccgc
aaggctgtggccatgagcctcttcaattattcggcccaacgtggcctgccccgcggcaat
gccatacgcctgatgaaaatgcttgcggcatgcaaatgcaacgacaatgccggcggcaat
atggacgatgtgacagtcattatgctgatggctctgctgtactcttatgatacgtccgtg
ctgctcatctcggatgtggttaatccgtacacgggccggttgcccatcatgtgggatcca
gagtttgccaagagcttccacgaggccttgtacgcccaggccaaatggcagacgccgcgc
ctcgatgccatcatcaagtacagctttgccctggccctggccagcctgcggcaagcgccc
agccacctgcaggcggccgccagtgcgctgataccacgcgatgagcagctaatggatgag
gcactggcctccaatgtctttggcttcatctaccgtcagttgctggagaatgaagtgatt
tacaacacggagtccatttatcgacgggcgcatctactgatcaccgatttcattgatttc
atgcatgccaaagtggccgagctgcgcaaccgggcggacgagtccgcgcgcacggtgatt
agtttcctgaatgaaggcctcgagccgccgccaaatctggacgcaaacttcgagctgcta
atgctgtgcgtgtcccgtctctacggcgatcgacgggccaaccacaccctgtgcaacgag
tattggggggccagcgacacggccacatcagccggcagcggcggtggcagcggcggcggc
ggcggcagcggcagcggcaacaatgccggcctctatgccatgaacagctcccgggctgtg
tccctattcaagttcatatccttggccagcgaactgctgccacagacgctgttcaagtcg
tacctgaagatgatcacgggcctcacgcgcacagagctgtcggcccgcagtgccttcaat
ctgctcaagaacacgccctcgggctcctcgagcttttcgatgggctgggaccacttcttt
caggcattggccagctactacagcaacatgcgcacggataacgccttcagcgttatgtcc
ccgggcagtgcctcgaatggcgatcttttcatgcggcgagccctgcagccccggaacata
actcagcgcgaaacggagcatctggtggctgtgatggggatcatgcgcgcggtggccgag
cacgatcgcgtgtcccgggtgatgatgtgcgatcaggccagctggcaggcgccacaggtg
ctgctgggactggtggcatgtgccacaccgctggccctcaaggcagagatcatgtttacg
ctggcggccttggccaagtccaaggagacggcgcgtgccatttggttccagctggaggac
tcgcagataatacccacgctggtggtgacgacgacagcggcgggacagagcccgtgcagc
ctggccgaggagatcgagcagaacgagagccgtcaggagtcgtacaacttgagtcgcggc
gttctccagctgctccacacactgatgaccacccatatgcccaggtgcttgggcgccggc
ccgcggcaccctggctacgatccgtatttcaatttcctgatggagtccataatcctcaag
gtctacaatcgctcgtacaaggaccccagcgaaatgtgggaggtggccgccaagggattg
aagcttttattctatctgctggccacgtaccggccgaaggccagcgattttatggaatcg
cgcgacgagcagccgtatccgggctaccatgtgatgctgcagctgcaggtgaaatcgcac
ctattgcagctcctgctgcgcatcatcgaggatgcccgcgagcggctggacgagtacagg
cgctttcggggcaaggaacacctggaggagtgcgccctgtacgccctactgctgctcgag
gtggcggtggccaaacagaatgccttcttcgaggcacactcgtccgccaatagtcccatt
ctgatgtcgggactcgaccggatgctgttggacatcaatccgcgcacccgacgacccgat
tacgtggtgaaaatcattaagtttgtgacctacaacaattggctgccgcggcactcgctg
gcggccatcaagatactgacagcggtgaccatgctgccgaacgtcccctcacagatcctc
aatatgtatgccctcggcagcaacgagaagctcgaggtgcgccagggatttgtcgagtgc
ctggaaatggacgcccgtttggcccaacagaacgaagagctcctcgattcgattgtgctc
aacgactaccaggccatgggcgatgtgctccaccacggaggccaccagccgccgagtgtg
gccgtcgacgaggatgaatcggaggcggacataaccggtcccgaggacggggacaccacc
ttgggcccttgctacgaagtggtggccctcaatgagaagatgcccgtcggcattgatctg
cagatcaaagaggctgtggtcgagctctttggactcaatctgtgtcaagcgccgccgaat
ttcgtttactttctgctgggcatcgatgtcctcagggactttatggccagggataagcag
caggtcggcattgaaatgcagtgctgttgtgtgcattccttggttttggtcctggaaaag
tatctcgagagccaacggcatagccaggagaaatactgcccccatacggcccatctggtg
gagagagtctatcagctgttccagggcctgtgcgccaatcgtcggtcttcggagaccatc
ctgcgcttctttcgcttgacctgcaatgacttcctgctgcgccatctgagcgccatgccg
tttcgccgccaccgcgaggatcatatgctgcacgccatgagccatttgctcaattgtgtg
gccgtcgaggtgcgcctggcggccaatcatggccagatgacgcgctacaatctgttgtgc
gacatactcctgctgggcggccagtcggatgggcagcgtgcgaatcccggcatgccgcag
gacctcaacaacgacatactgagcggcacggcctgcgctaacttctatggcctggacgtg
ggccccgtcgcggcggccgttaagacacccgcgatgcccgataagacccaaggactgcat
gcgaatcgtttgctggagtgtctggagctcgaggtgaatgccactgcgccccagccgcag
ctggagttcttcgatccggtgctgacgacagcggtgctgaagcagtgcgaggcccgcccc
cgaccgagtccaggcagcggcagtgagagcggaactgccgcgggctctgagccatacctg
atgataaacatccgcaaactccacgacgtcctgcacgaagagctgcgtacggtgcagagc
accattgccacgggccagcgcaaggccatcagtggggagatcaccgtgctgctgcagtac
gccgtcgaggtgaaccgcgtgcggacacagcggatcgccacgctgcggtttgtggatgcg
tggtgccagctggtgcagatactgttcagcagcatgcccgacgccctgctgccgctggcc
ctgaggcgtcagtacatcattgatatcatcgagaagatgctgctgaaggtggagcccgtg
cagccgctaatcgagatctccatacagatcaccgaaacgatcctgctgctgctggccaat
ctgcgcatctgctattaccagctggaggatcagcggaccagcgatgattgcgatgtgacc
gccgcccaaaacggcgacaacagcctggtcaacggcccgctctccctttcatattcgcac
gcccattcgcagtcgaacatcagcggcacaatgacgggcagcacgagcaatctgcgcttc
atcctgaaacgcatcgtcgagtggatcatggtgagcggcgccaagtcgcagaagctgcgc
atcaatctctatacggctttgctcaattgcctgcggatcgtgaagcgtctgcgcaccgag
gaggaggtggactttcatgaaagcattgcctcgcgcctggagaaatcgcaaaaggccgtc
accgatcagcggcacggcgataaggaccggctcaaggagatggccgcggaggtgatcggg
gtctatggggagaagctgattgattcgatctgccacgacgcggtgaccggacacgatgtg
tgccgcatgctggcgctggcctgcctggagatgatctctgaactggatgcggtgagcacg
ctcaccgaatttgtggtgtcgcgcggctacctgaagcacctgctggacaacgtcgcagaa
tcggacgatgctctgagcgccatcctgcaaccagtgccggacaatctgcggcagttgtac
gtgtacgaggcgcgtttggccttcctcacgcgcctgtcgcagacgggtgcccgcatgttg
ctcgccgaaggagccctgggcgtcctgtccaatatgcgggtgtacgacctgcagccggac
ctgaaggccaaccaattgcgaaaagatccggagggctttctgccgaacacgtctaagcgt
ttccattccatcctgcagccggccctggccctttgcgatggcattgtcagctccctggga
tcgcagaacgattcggccgcccaccaggtgctcaactttctgttcgcccacatcgacatg
gtcgagacgatgctgcgcacggccacgcccctgatggacctgtggcacctgcagcagctg
gcgtcgatcacgaatctgttctcgcgcacctccacgcccgaactgtgcaccaatatggct
gatagctacgtccagaaacgcgatctggagttctataatcgcctgaatcgcctgcagcag
ctgatgatcgtggtctttggccgtttcactgtgaccgaggccaccattcgccagatactc
cagcaggaggacgtggagtccctgcccgagagtcaaaagagtcgtcacgtcaagtatttc
ctggacattgccgccaatctgtcgctctattgccgccatgcggtgaccagtcatgtccgc
gacagcaccacctccaagtttctcctaacgacgatagtcaatgatgttacaccactgact
ggcaggacagacggcaagaagctgacggccattatgcacacaatcatcgaacagctgaag
ggctccgtgggctactacctttcgcagaagtcgcatgccgacaacctgctggagcagcgc
tcctcgctgccaaacatctgcttcggcccgagcggtaaagaaagctacgtggagctcagc
cagcggcacaaggagaagcgcaacgaactgatgcaggccgtctttatagccgaacagaat
ctgtatttgctgtggatccacttggacttttatatgcgtaatgcggtgatattttccagc
gagaatcgcagtgccatcaacgagagcaatatggagagttccagcggaaacgacagcgtc
tccgtgctgcatgccacccccgatgagatcctccagctgaagcagcatctcatctccacc
tttaacgagaccttctgctcggagctgatcgtcgccagtgaagagtatacggtcaagtgc
aagggcttcaatagttcactgttgcgacgcatcaaggcgttggtgcagtttgctgcctcc
aatgggaatgccaacgagagttctttcatatag

DBGET integrated database retrieval system