KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11336Help
Entry
Dpse_GA11336      CDS       T01032                                 

Definition
GA11336 gene product from transcript GA11336-RA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dpse_GA11336
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dpse_GA11336
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dpse_GA11336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 238 aa AA seqDB search
MSLRQFQTISQQVFRCLSTRAATSRRILGPVIELSQSQRQNLKFCTVLLPVSCAAAVSAP
QYSTAAAIDMSANGDYKNAASIYEFTVKDTHGSEVSLDKYKGRVLLVVNIASKCGLTKNN
YQKLTELKEKFGERGLTILNFPCNQFNSQMPEADGEAMVCHLRDAKADIGEIFARVDVNG
DNAAPVYKYLKAKQSGTLGSGLKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDIEKLL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaggcagtttcagaccatttcgcagcaggttttcaggtgcttatcgactcgg
gccgcaacaagtcgaagaatccttgggccggtcatcgaactgagtcagagtcaaaggcag
aatctaaaattctgcacggtcctcctgccagtcagctgtgcggcagccgtcagtgccccc
cagtactccacagcagctgccatcgacatgtctgccaacggagattacaagaacgccgct
tctatctatgagttcaccgtaaaggacacccatggaagtgaagtgtcgctggacaaatac
aagggccgagtacttctggtagttaatatcgcttccaagtgcggactgactaagaacaac
tatcagaagttgaccgaattgaaggagaagttcggcgagcgtggactcaccattttgaac
ttcccctgcaatcagttcaactcccaaatgccggaggccgacggcgaggcaatggtctgt
catctgcgcgatgccaaggctgacattggagaaatctttgccagggtggatgtcaatggc
gataatgctgctccggtctacaagtacttgaaggccaaacagtctggcactttgggcagt
ggtctcaagtggaactttacaaagttcctggtcaacaaagagggaatcccaatcaatcgt
tatgccccaaccaccgatcctatggacattgccaaggatattgagaaactattgtag

DBGET integrated database retrieval system