KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11372Help
Entry
Dpse_GA11372      CDS       T01032                                 

Definition
GA11372 gene product from transcript GA11372-RA (EC:2.7.11.-)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dpo04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dpo04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 356 aa AA seqDB search
MGPPPGETPMHFSPKTDYLLILDKLREDFNKKFAQNVPSPGTGLDTFEIKSTLGAGSFGK
VQLVRERESGQYFASKQLSKDQIVKTKQVMHVMSEKNVLRSIHFPNTVYLIASFKDFDSL
YLILPLIAGGELFSYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMIDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLIFEFVAGSS
PFSAHNRDVMAMYNKICEADYKMPSYFSGSLRHLVDHLLQVDLSKRYGNLINGNKDIKEH
EWFKDVEWIPLLNQTVHAPYVPNLANSEDTTHFDKINEKPRSKAKNMRHEEIFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctcctcctggcgaaacgcccatgcacttcagccccaagacggactatctcctg
atcctggacaagctgcgggaggacttcaacaagaagttcgcgcagaacgtcccgtcgccc
ggaacgggcctcgacaccttcgagatcaagtccactctgggggcgggctccttcgggaag
gtgcagctggtgcgggagagggagtccggccagtactttgcctccaagcagctgagcaag
gaccagattgtcaagaccaagcaggtgatgcacgtgatgagcgagaagaacgttctgcgc
tccatccacttccccaacacggtctacctgatcgcctcgttcaaggacttcgacagcttg
tacctcatcctgccgctcatcgccggcggcgagctcttctcctaccaccgcaaggttcgc
aagttcaccgagaagcaggcccgcttctatgcggcacaggtcttcctcgccttggagtac
ctccaccactgcagcctgctctaccgggacctcaagcccgagaacatcatgatcgacaag
aatggctatctgaaggtgacggactttgggtttgccaagaaggtggagacccgaacgatg
acactgtgcggaacgcccgagtacctgccgccggagatcatccagtcgaagccgtacggc
accagcgtggactggtgggccttcggggtgctcatctttgagtttgtggcagggagctcg
cccttctccgcgcacaaccgcgacgtgatggcgatgtacaacaagatctgcgaggcggac
tacaagatgccctcgtacttcagtggatctctgcggcacctggtggatcatcttctgcag
gtggatctgtccaagagatatggtaacttgatcaacggcaataaggacatcaaggagcac
gagtggttcaaggatgtcgaatggataccgctgctcaatcagacggtgcatgccccctat
gtacccaacctggccaactccgaggacacgacccactttgacaagatcaacgaaaagccg
cgatccaaggccaagaacatgcgtcacgaggagatttttgcggacttctag

DBGET integrated database retrieval system