KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11372Help
Entry
Dpse_GA11372      CDS       T01032                                 

Definition
GA11372 gene product from transcript GA11372-RA (EC:2.7.11.-)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dpse_GA11372
   04340 Hedgehog signaling pathway
    Dpse_GA11372
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dpse_GA11372
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dpse_GA11372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 356 aa AA seqDB search
MGPPPGETPMHFSPKTDYLLILDKLREDFNKKFAQNVPSPGTGLDTFEIKSTLGAGSFGK
VQLVRERESGQYFASKQLSKDQIVKTKQVMHVMSEKNVLRSIHFPNTVYLIASFKDFDSL
YLILPLIAGGELFSYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMIDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLIFEFVAGSS
PFSAHNRDVMAMYNKICEADYKMPSYFSGSLRHLVDHLLQVDLSKRYGNLINGNKDIKEH
EWFKDVEWIPLLNQTVHAPYVPNLANSEDTTHFDKINEKPRSKAKNMRHEEIFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctcctcctggcgaaacgcccatgcacttcagccccaagacggactatctcctg
atcctggacaagctgcgggaggacttcaacaagaagttcgcgcagaacgtcccgtcgccc
ggaacgggcctcgacaccttcgagatcaagtccactctgggggcgggctccttcgggaag
gtgcagctggtgcgggagagggagtccggccagtactttgcctccaagcagctgagcaag
gaccagattgtcaagaccaagcaggtgatgcacgtgatgagcgagaagaacgttctgcgc
tccatccacttccccaacacggtctacctgatcgcctcgttcaaggacttcgacagcttg
tacctcatcctgccgctcatcgccggcggcgagctcttctcctaccaccgcaaggttcgc
aagttcaccgagaagcaggcccgcttctatgcggcacaggtcttcctcgccttggagtac
ctccaccactgcagcctgctctaccgggacctcaagcccgagaacatcatgatcgacaag
aatggctatctgaaggtgacggactttgggtttgccaagaaggtggagacccgaacgatg
acactgtgcggaacgcccgagtacctgccgccggagatcatccagtcgaagccgtacggc
accagcgtggactggtgggccttcggggtgctcatctttgagtttgtggcagggagctcg
cccttctccgcgcacaaccgcgacgtgatggcgatgtacaacaagatctgcgaggcggac
tacaagatgccctcgtacttcagtggatctctgcggcacctggtggatcatcttctgcag
gtggatctgtccaagagatatggtaacttgatcaacggcaataaggacatcaaggagcac
gagtggttcaaggatgtcgaatggataccgctgctcaatcagacggtgcatgccccctat
gtacccaacctggccaactccgaggacacgacccactttgacaagatcaacgaaaagccg
cgatccaaggccaagaacatgcgtcacgaggagatttttgcggacttctag

DBGET integrated database retrieval system