KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11383Help
Entry
Dpse_GA11383      CDS       T01032                                 

Definition
GA11383 gene product from transcript GA11383-RA (EC:3.1.2.15 3.4.19.-)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA11383
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA11383
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA11383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 829 aa AA seqDB search
MEELRKHLSKVNVICASGASSPPVYKDECVYSYDNPETPTGLYVCLHSFLGFGEAHVREY
ASKTGNAVFLHIKREKTLKKDESAEQEKKEAAAEAPPESKITRLAIGVDGGYNETDLAKK
YEIKDTYSIVVAPELDKKLPYPDPELPIRVSQAIEGILAADSAISKLEKSTLMGTWDGEV
RQASKYAENLEQLNNGKRIPPSGWQCEKCDLTSNLWLNLTDGSILCGRKFFDGSGGNDHA
VEHYRVTNYPLAVKLGTITADGKSDVFSYPEDDMVIDPHLEKHLSHFGINMAAMKKSEKS
MVELELEINQRIGEWSALTESDSELQPMAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQE
RFVGTGAERYFSEFPSDPANDFNIQMAKLGNGLQSGKYSSIVENTLDTDNLSGISPAMFK
NIVGKNHPEFSTKQQQDANDFYLHLLTMLDRNSRNQSNPADALKFLLEDRVECLASRKVK
YKKREEYSFRLPIPLEKATNLDEVREYQERDQAARESGQRLVDRDIVRHKVPLRACLERF
FGTELIEQFYSTAINGKTNAEKTTRMATMPDFLMIHLGKFTLGDDWVPKKLDVSVDMPDD
LDLSAWKSTGGGLKPGEEPLPEPAAEQPKFTFDDAVMSELLNMGFPHEACKRACFHTKNS
GLEAASNWLMEHIADEDISDPFEVPNNSIGDCASEQFVANPESLAMLMSMGFDERQAVAA
LKATDGNVERATDWIFSHADSIPMDETPAVATPATSAPSTSAAANYRDGTGKYKLVAFIS
HMGTSAQVGHYVCHIRKNGEWVIYNDTKVAKSQNPPKDLGYLYLYMRDE
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacttcgcaagcatttatcaaaggtcaacgtgatctgcgcctcaggcgctagc
tctccgccagtgtacaaagacgagtgcgtctattcatacgacaacccagagacgcccacc
ggcctatacgtgtgcctgcacagtttcctgggctttggcgaggctcatgtgcgcgaatat
gccagtaagactggcaacgcggtcttcctgcacatcaagcgtgagaagacgctgaaaaag
gacgagagcgcagaacaggagaaaaaggaagccgctgccgaagccccgccagagagtaag
atcacacgcctggccattggggtggacggcggctacaatgagactgatttggccaaaaag
tatgagattaaggacacctacagcattgtggttgctcccgagctggacaagaagctgccc
tatcccgatcccgagctgcccattcgcgtgtctcaggcaatcgaaggcattctggcagcg
gactcggcaatttccaagctggagaagtccacactgatgggcacatgggatggtgaggtc
cgtcaggcatccaagtatgcagaaaacctcgagcagctaaataacggcaagaggattccg
ccatccggttggcagtgtgagaagtgcgatttgaccagcaatctctggctgaatctaacc
gacggctcaatactctgcggccgaaagttctttgatggcagcggtggcaacgatcacgct
gtagagcactatcgcgtgaccaactatccgctggccgtcaagctgggcaccatcaccgcc
gacggcaagtccgatgtgttctcctacccggaggacgacatggtcatcgatccgcacctg
gagaagcatctctcccactttggcatcaatatggcggccatgaagaagagcgagaaatcg
atggtcgagctggagctggagataaaccagcgcatcggcgaatggtcggccctgaccgag
agcgatagtgagctgcagcctatggccggaccgggatacacaggaatgcggaatttgggc
aatagctgctacatcaatagcgtgatgcaagtgctctttgtcattcctgacttccaggag
cgttttgtcggcaccggggctgagcgctactttagtgagttccccagcgatccggcgaac
gacttcaacatacagatggccaagctgggcaacggcctccagtcgggcaagtacagcagc
atcgtcgagaacacactggacacggataacttgtcgggcatatcgccggccatgttcaag
aacattgtaggcaagaaccatccggagttcagtaccaagcagcagcaggatgccaacgac
ttctatctgcatttgcttacgatgctcgatcgcaattcgcgcaatcaatcgaatccggcg
gatgccctgaagttcctgctggaggatcgcgtggagtgcctggccagccgcaaggtcaag
tacaagaagcgcgaggagtacagcttccggctgcccataccgctggagaaggccaccaat
ctggatgaggtcagggagtatcaggagcgggaccaggcagcccgcgagagcggacagcgt
ctcgtcgatcgcgacattgtccgtcacaaggtgccgctgcgggcctgcctggagcgcttc
ttcggcacggagctcatcgagcagttctactcgacggccatcaatggcaaaacgaacgca
gagaagaccacacgcatggccaccatgcccgacttcctcatgatccatctgggaaagttc
acgctgggcgacgactgggtgcccaagaagctggacgtctccgtggacatgcccgacgat
ctggatctgagcgcctggaagtccaccggcggtggcctaaagcctggtgaggagccactg
cccgaaccggccgccgagcagcccaagttcacgttcgacgatgcggtcatgtcggagttg
ctcaatatgggctttccccatgaggcctgcaagcgggcctgcttccacaccaagaacagc
ggcctggaggccgcctccaactggctaatggagcacattgccgacgaggacatctccgat
ccgtttgaggtgcccaacaatagcatcggcgactgcgccagcgagcagtttgtggccaat
ccggaaagcctggctatgctcatgagcatgggattcgatgaacgccaggccgtggccgcc
ctcaaggccaccgatgggaatgtggagcgtgccacagactggatcttctcgcatgccgac
agcatccccatggacgagaccccggccgtggcaacaccggcgacctctgctccttccact
tctgccgccgccaactatcgtgacggcacgggcaagtacaagctggtggctttcatctcg
cacatgggcacctcggcccaggtgggccactatgtctgccacatccggaagaacggcgag
tgggtcatctacaacgacaccaaggtggcaaagtcgcagaatccacccaaggatctcggc
tacttgtatctgtacatgcgcgatgagtag

DBGET integrated database retrieval system