KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11426Help
Entry
Dpse_GA11426      CDS       T01032                                 

Gene name
Dpse_Adam
Definition
GA11426 gene product from transcript GA11426-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 240 aa AA seqDB search
MADDWESAADSEIILQNAASTVNKWEGEDDDDDVKESWEDEEEKKDEENEKPTITDVPVK
TKPSKALKAKLEEQARLEEEKEAKRLASLTPEEKLAEKLRLQKIQEDSDLNHALDTFGVT
RAETNGNGLDSFNPETKEQFKEFGSALSWKVGQYRESAEFPQFVEDLVRGLCIHLSAADI
KKVKMSVEILHSEKLKMEKAIAKKAAGKNKGKATLRTESDDIDDYKKYGNDFSEDYDDFM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgactgggaatctgcagccgacagtgaaatcatacttcaaaatgcagcaagc
accgtaaacaagtgggagggggaggacgacgacgacgatgtgaaggagagctgggaagat
gaggaggagaagaaggacgaggagaacgagaagcccacaataacagatgtgccagtcaaa
accaagccaagcaaagcgctgaaagccaaactagaagaacaagcgcggcttgaagaggag
aaggaagcgaaacggctggccagcctcacacccgaggagaaattggccgagaagctgcgg
ttgcaaaagatccaggaagactccgatttgaaccacgccctggacacattcggagtgacg
cgtgcagaaacaaacggcaacggcctagactccttcaacccggagaccaaggagcagttc
aaggagttcggttctgcgctcagctggaaggtcggccagtatcgcgagtctgcggaattc
ccacaattcgtcgaagacctagtgcgcggtctatgcatacacctgagcgccgctgacatt
aagaaggtcaagatgagcgtggaaatcttgcactcagaaaaactcaaaatggaaaaggcc
attgccaagaaagccgccggcaagaacaaggggaaggccacgcttcgcacagagagcgat
gatattgatgattacaaaaagtatggcaatgatttttccgaagattacgacgacttcatg
tga

DBGET integrated database retrieval system