KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11461Help
Entry
Dpse_GA11461      CDS       T01032                                 

Definition
GA11461 gene product from transcript GA11461-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA11461
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dpse_GA11461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 712 aa AA seqDB search
MTKDTESSVTDGSQNDTSDTLRFRQLIKGDIKQDSLREFVSYTADGDRITLVGAKSDVIT
LEMTSKASCHVPFPFIVACLDSPVNERPLDVLHAGVNLVDIYENCHVLEAQQLSLEPVYM
TICSTEVPESRLVASKWSPQILSNGQMLLAALNTYGAITLLCKPAEHTHWSRLDGLNVST
TLRDTLLPVRNVSKIQNFKQFKAFIDRAWITMFTWRPANEPNAGHVLVLGTANGSLWSLT
LSSDARTLLQHRVLNTSLNRICYMLAFEDLLLVGDVSGVVHLYRFNNDEESGLSLIRVVW
EKADRMGLQKAIISRITERECYYISLCKAANLLIWCIPWQEGNEWLHTRIYVGGMKITGL
CTLDSTSFAVATSTSKLYRINLSQEDKKLTASMQPVAIDDCEDYQMIGLFSSRQRNLLTV
LFHPNKEYAGNIYATSLRNQLKLRVGKIHNGNILTKLADTFQPNTPINQSTDLLAELRLE
LFATSKNLQKYINFHRLTAFQFDKEATESQQHQLQLKYHIMATIFHLRANLLWLTLQTEE
SHKEMQLLLAMLAMTHMRLRLKYLCSLKELSPFQKEAAQCMFAEAQRLKKLLLEDSRKGL
DSPETENLPNSKGTHDRHCFQEAFVQQMKINFDDLHAQLGKDVIEIPEEEQPKRRCCVSY
LQLPLSLDRRYCSQCSRPVLVDQEKLLQLYEPGSTLLCPCCHGSYALDLATA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagatactgaatcgagcgtcacagacggcagccaaaatgatacgtcggatacc
ctgcgattccgtcaactaatcaaaggagacatcaagcaagactctctgcgggagttcgta
tcctacacagctgatggggatcgcatcaccctggtgggcgccaagtcggatgtcataacc
ctggagatgaccagcaaggccagttgccatgtgccttttccctttatcgtcgcctgcctg
gactcgcccgtaaatgagcgccccctggatgtactgcacgcaggagtcaatcttgtggac
atctatgaaaactgtcatgtgctggaggcccagcagctctctctagagccagtttatatg
accatttgttcgacagaagtgccagagtccagactagtggcctcaaaatggtcgccacag
atcctgtccaatggacaaatgctattggccgccttgaacacctatggagccataacactc
ctatgcaagcccgcggaacacactcactggagtcgactggacggcctgaatgtgtccaca
acattgcgggatactctgctgcctgtaaggaatgtttcgaaaatacagaacttcaagcag
tttaaggctttcatagatcgcgcctggatcacgatgttcacttggcgtcctgcgaatgag
cccaatgccggacatgtcctagtcttaggcacagccaacggctccttatggagtcttact
ttgagttctgatgcccgaacgttgctgcaacatcgcgtactgaacacctcgttgaaccgc
atctgctatatgcttgctttcgaagatctgctgctggtgggcgacgtatctggagttgtt
catctctacagatttaacaacgatgaagaatccggactgtctttgatacgggttgtgtgg
gagaaggcagatcgcatgggacttcagaaggcgataatctcgcgaatcacggagcgagag
tgctactatatatccctctgcaaggcggcaaatctgctaatttggtgcataccatggcaa
gaaggtaatgagtggctgcacacgcgcatctacgtaggaggcatgaagataaccggtctc
tgtacgttggacagtaccagcttcgctgtagccacgtcaacgagtaagctataccgaata
aacctttcccaagaggacaagaagctcactgcatccatgcagccggtagctatagacgac
tgtgaggactaccagatgattgggctgttcagcagcagacagagaaacctcctgacagtg
ctcttccaccccaacaaggaatacgcgggtaacatatacgcaacctctctacggaatcag
cttaaattacgcgtaggcaagatccacaacgggaatatactgaccaagctagcagacacc
tttcaacctaacacgcccatcaatcaaagtacggatctgctggccgagttgcgcctggag
ctctttgccacaagtaaaaacttgcagaaatacatcaatttccatcggttgacggcgttc
cagtttgacaaggaggctacggaatcgcaacagcatcagctgcaactgaagtaccatatc
atggcaactatttttcacctgcgagcgaatcttctctggctgacactgcagacggaggaa
tcgcacaaggaaatgcagctgctgctggcaatgctggccatgacacacatgagactgaga
ctgaagtacctgtgctctctgaaggaactaagtccgttccagaaggaggctgcgcagtgt
atgtttgcagaggcgcaacgcttgaaaaaactgctgttggaagactcgcgcaaggggcta
gactcccccgagacggaaaacttgccaaattcgaagggcacgcacgacaggcattgcttt
caagaggcgtttgttcaacaaatgaaaataaactttgatgatttgcatgcccagctggga
aaagatgtgatagaaatccccgaggaagaacaaccaaagcgacggtgctgtgtgtcttat
ctgcagcttcctttaagcctggatcgacgctactgtagccagtgcagtcgtcctgttttg
gtggatcaggagaagctgctgcagctgtatgagccaggctccactctgctgtgtccttgc
tgtcatggaagctatgcattggatctcgcaactgcgtga

DBGET integrated database retrieval system