KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11504Help
Entry
Dpse_GA11504      CDS       T01032                                 

Definition
GA11504 gene product from transcript GA11504-RA (EC:2.7.11.-)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dpse_GA11504
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dpse_GA11504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 338 aa AA seqDB search
MSRPRPRPQPISIHREPEQALVPPRNLDSRATIQIGDQTFDIDADSLERICDLGRGAYGI
VEKMRHRQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMSTSLDKFYPKVFKHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGRYPYDNWRTPFEQLRQVVEDNPPRLPAGTFSPEFEDFIATSLQKEYMARPNYE
QLLKHSFIVEHLQRNTDISEFVARILDLPDEQPQQPTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgtccccaacccatcagtatccaccgcgaaccggaacaagct
cttgtcccgccacggaacctggactcccgtgccaccatccagatcggggaccagaccttc
gacatagatgccgacagcctggagcgaatctgtgatctgggacgaggtgcctacggcatt
gtggagaagatgcgacatcgccagacggacacagtgctggcagtaaagcgtataccgatg
accgtcaatatacgggagcagcatcgtctggtcatggacctggacatatcgatgcgatcc
agcgactgcccctacacggttcacttctatggggcgatgtaccgcgagggcgacgtctgg
atctgcatggaggtgatgagcaccagtctggacaagttctatccgaaggtcttcaagcac
gacctgcgcatggaagagagtgtgctgggaaagattgccatgagcgtggtcagtgctctc
cactatctgcacgcccaactgaaggtcatccatagagatgtgaagccttcgaacatactg
atcaatcgcgccggccaggtgaagatctgtgactttggcatctcaggttatctggtggac
tccattgccaagacaatcgatgccggctgtaagccgtacatggcccccgagcgcatcgat
ccacaagggaatcctgcacagtacgacatacgctctgatgtgtggtcgctgggcataagc
atgattgaaatggccaccggccgctatccgtacgacaattggcggacgccattcgagcaa
ctgcgacaggtggttgaagacaatccacccaggctgccggcgggcacattctcgcccgaa
ttcgaagactttatcgccaccagcctgcagaaggagtatatggcgcggcccaactacgag
cagctgctgaagcacagcttcattgtggagcatctgcagcgcaatacggacatttccgag
tttgtggccaggatactggatttgccggacgaacagccgcagcagccgacaaagtag

DBGET integrated database retrieval system