KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11532Help
Entry
Dpse_GA11532      CDS       T01032                                 

Definition
GA11532 gene product from transcript GA11532-RA
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dpse_GA11532
Mitochondrial biogenesis [BR:dpo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    Dpse_GA11532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 439 aa AA seqDB search
MANVLTNPRYMYGPTAALELTAVLDQVDNNTNATQLFKNNIYNIMNEYNREEARLKTFAN
WPLAWLDKHQLARTGMFYTNDNDKVKCYFCEVEIGRWDLDDQPVPEHLRWSPNCPLLRRR
TTNNVPLNSEALDRILPPISYDICGANDSTVELRESAYAEGRIPMSHIAQSIATNTAVSP
LMSSIATSTAATQANGDVHPESCRQVASGNYFPEHPEYAVESTRLRSFEEWPRNLKQKPM
QLAEAGFFYTGVGDRVRCFSCGGGLKDWDDNDEPWEQHALWLSQCRFVKLMKGQRYIDTV
AAKPEPVAEKEESSTSADETPAAASSTTTTPAATATVETPFGDVGPSAATCIYEKIVSSA
STTTATGAIPGTAGGPPAAPNGSPVIPEEKLCKICYAAEYNTAFLPCGHVVACAKCASSV
TKCPLCRKPFSDVMRVYFS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtattaaccaatccgaggtacatgtatggaccgactgctgcactcgagttg
acagcggttctcgaccaggtggacaacaatacgaatgctacgcagctgttcaagaacaac
atctacaacatcatgaacgagtacaatcgggaggaagcgcgcctgaaaaccttcgccaat
tggcctctggcgtggctcgacaagcatcagttggcccgaacgggcatgttctatacgaac
gataacgataaggtcaagtgctatttctgcgaggtggagatcgggcgctgggatctcgat
gatcaacctgtacctgagcacctgcgctggtcgcccaactgtccgctcctgcgccgtcgc
accaccaacaatgtgccgctgaacagcgaggccctcgaccgcatcctgccccccatcagc
tacgacatttgcggcgccaacgactcgacggtcgagctgcgcgagagcgcctatgccgag
ggccgcatacccatgtcgcacattgcccagtccatcgccacgaataccgccgtatccccg
ctgatgagctccattgccacctcgacggcggccacccaggccaacggggatgtccatccg
gagtcgtgtcggcaggtagccagcggaaattattttcccgagcaccccgagtacgccgtg
gagtcgacccgcctgcgcagcttcgaggagtggccgcgcaacctgaagcagaagccaatg
cagctcgccgaggcgggtttcttctacacgggcgtcggcgaccgcgtccgctgcttcagc
tgcggcggtggtctcaaggactgggacgacaacgacgagccctgggagcagcacgctctc
tggctgagccagtgccgcttcgtcaaactgatgaaggggcagcgatacatcgacactgtg
gctgccaagccggagccagtcgcagagaaagaagagagcagcacaagcgcagacgagacg
ccagctgcagcttcctccactacaacgacaccagccgcgacggcgacagtcgagacccct
tttggcgatgtgggcccatcggcggccacttgcatatacgagaagatcgtgtcgagcgcc
agtaccaccacggcaacaggggccattcccggcacggctggaggtcccccagcggcgccc
aacggctcgccggtcattcccgaggagaagctctgcaagatctgttatgccgcagaatac
aacacggcgtttttaccctgcggccatgtggtggcctgcgccaagtgcgcctcgtccgtg
accaagtgcccgttatgccggaagcccttctccgatgtgatgcgtgtatatttttcttaa

DBGET integrated database retrieval system