KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11548Help
Entry
Dpse_GA11548      CDS       T01032                                 

Definition
GA11548 gene product from transcript GA11548-RA (EC:2.4.1.-)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dpse_GA11548
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dpse_GA11548
Glycosyltransferases [BR:dpo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dpse_GA11548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 749 aa AA seqDB search
MAASVVKTPKCPRRGSAKEQQSKASPKSNNESNNWHWWILLASVFLITFATRFYKVTEPD
HICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNETA
YQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLSAAYLIFDVGLLTLNQYILLDPILL
FFMMGSVWGMVKISKATASGGSYSVRWWFWLFLTGTMLSCTISVKFVGLFVVLLVGLHTA
TELWLILGDLGQPIVETLKQIACRAIALILWPILLYTLFFYIHLSVLNRSGNGDGFYSSA
FQSRLIGNSLYNASMPRDVAYGSVVTIKNHKTGGGYLHSHFHLYPKGSGARQQQITTYTH
KDDNNKWVIKPHNKQRLPKDKLQLLRHGDLVRLEHLVTKRNLHSHSEPAPMTKKHLQVTG
YGESGVGDANDVWRVLIVGGKVNETVHTVTSRLMLIHYLQNCALTSSGKQLPKWGFEQQE
VSCNLNVRDKYAHWNVEDNEHKLLPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKEGE
VTSRPWQWPINYRGQFFSGSSYRIYLLGNPVIWWSNLVFLALFVAVFLGNAILEQRRAGQ
ARALVRSQADSEDSEPSTTDVPLCTCCPEEQQLLSRPREEHRDPLGAAAWLFVGWLLHYL
PFWAMGRVLYFHHYFPALIFNSLLTGVMFHHIIQSLPRWIQHVLLGGLLSLIVYSFALFS
PLAYGMSGPLANEPNSTMHSLKWLSTWEF
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcagctagcgttgttaaaactcccaaatgtcccagacgaggatcggccaaagagcag
cagtccaaggcctcacccaagtcaaacaatgagtcgaacaattggcattggtggatccta
ctggcatccgtgttcctcattacttttgccactcgcttctacaaggtgaccgaaccggat
cacatctgctgggatgagacacactttggcaagatggggagctggtacatcaatcgaaca
ttcttctttgatgtccatccaccgctgggaaagatgcttattggactctctggctacttg
actggctacaatggaacgtttccgtttgagaagccgggggataaatacaacgagaccgcc
taccagggcatgcgatatttctgtacgacactgggggccctgatcatgcccatgggcttc
gatactgtctacgatctgacgcgatcacacgaagcggccctgctctcggcagcctatctc
atatttgacgtgggactgctgacgctgaatcagtacatcctgttggaccccattctgctg
ttctttatgatgggctccgtctggggcatggtgaagatctcgaaggcgacggcctcgggt
gggtcctactcggtccgctggtggttctggctcttcctcaccggcacgatgctctcgtgc
acgatcagtgtgaagtttgtgggtctgtttgtggtgctgctggtgggtctgcacacggcc
accgagctgtggctgatcctgggcgacctgggccagccgattgtggagacgctcaagcag
atcgcctgccgcgccatcgccctcatcctctggccgatcctcctgtacacgctcttcttc
tacatccatctcagtgtgctcaaccgcagcggcaatggcgacggcttctacagctccgcc
ttccagtcgcgtctcattggcaactcgctgtacaacgccagcatgcccagggacgtggcc
tacgggtccgtggtgactattaagaaccacaagacgggcggcggctatctccactcgcac
ttccatctgtaccccaagggatccggcgcccgccagcagcagatcaccacctacacgcac
aaggacgacaacaacaagtgggtgatcaagccgcacaacaagcagcggctgcccaaggac
aagctccagctgctgcggcacggcgatctcgtccggctggagcatttggtgaccaagcgg
aatctgcactcgcacagcgaaccggcgcccatgaccaagaagcaccttcaggtcacgggc
tatggcgagtcgggcgtgggcgacgccaacgatgtgtggcgcgttctcattgtgggcggc
aaggtcaacgagacggtgcacacggtcacctcccgcctgatgctgatccactacctgcag
aactgcgccctcacctccagcggcaagcagctgcccaagtggggattcgagcagcaggag
gtctcctgcaacctgaacgttcgcgacaagtacgcccactggaacgtcgaggacaacgag
cacaagttgttgcccagtgtcagctttagtgtgtacgctcctggcttcttcgcgcgcttc
ctcgagtcccatgccgtcatgctgcagggcaacgcgggcctcaagcccaaggaaggcgag
gtcaccagcagaccctggcagtggcccatcaactatcggggtcagttcttctctggcagc
agctatcgcatctatttgctgggcaatcccgtgatttggtggagcaatctggtatttctt
gccctcttcgtggccgtcttcctgggcaatgccatcctggagcagcgacgcgctggccag
gctcgggccctcgtccgctcccaagcggacagcgaggacagcgaaccctccaccacagat
gtgcccctgtgcacctgctgtccagaggagcagcagctgttgagccgcccgcgggaggag
cacagggacccccttggggccgctgcctggctctttgtcggctggctgctccactatctg
ccgttctgggccatggggcgggtgctctacttccatcactacttcccggcgctgatcttc
aactctctgctgacaggggtgatgttccaccacattatacagtcgctgccgcgatggata
cagcacgtcctgctgggcggactgctctcgctgatcgtctacagcttcgccctgttctcg
cccctggcctacgggatgagcgggcccctggccaacgagccgaacagcaccatgcacagc
ctcaagtggctgtccacctgggagttctag

DBGET integrated database retrieval system