KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11749Help
Entry
Dpse_GA11749      CDS       T01032                                 

Definition
GA11749 gene product from transcript GA11749-RA (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dpse_GA11749
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dpse_GA11749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 759 aa AA seqDB search
MAQSRKAQAAAAASAAAVALSYSISGEASSHRRPIASSPATHSSSRRSSLITCFISCHTS
SLLLLLLLLLLDGAQAVSRSSSGSGSGSNKTAAASGPNSGGATPIWDHAIDLNEDFRILW
QIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVDKGQTYFQDRHVTRNGDPEPV
VDPSQDYMLMLGYENATHTVLRFRRKLDTCDGTHDMAITNDTMRLLYMYHAQDPPHGSVR
PGTLPDPGRAFRPYRPMVLMQRAQLPMPSPTHDERVRVLELRNEDVELPGGDTPLFWCKM
FKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAHSELEEMAREQGRQCMGARSI
PLACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYLMETHYNNLKPDFAQLHARQMADN
SGLKIYFTHVLRPNDAGILSIGMDPNWRHIIPPGQKRVLSEGQCIEDCTGYAFPQQGINI
FAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQDFRRLPQSVHSLPGDRLIAEC
IYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHSLPSLPTVLHSLGIEQLATDS
NPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGSFKPICWGAKNHVVPGSEFLE
GYSINVTKTYKKHKRCKPKRLFVPITERTAPPPASDLSELPVLHELDNNNIIEGAARSSR
SSATDVHGLSLSRGNCREFVSCLLWLGASSWWLLLMLRT
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcagaaaagcacaggcagcagcagcggcatcggcagcggcagtggcactc
agctacagcatctctggagaagcatcatcacacagaagacccatcgcctcctctccagca
acacattcaagttcaaggcggtcatcgttaatcacatgttttatatcctgccacacgtcc
agcctcttgttgctgctcctcctgctgctcctcgatggagcccaggcagtcagtcgcagc
agcagcggcagcggcagcggcagcaacaaaacagcagcagcatctggacccaacagcggc
ggggcaacacccatttgggatcatgccatcgatttgaatgaggattttcgcatactctgg
caaatcattaatcaggatataacattcgaaatacaagcacgtacactcggctatgtcggc
ttcgggttctcgcccgatgggaatctggctggtgccgatatggccatcggttgggtggac
aagggtcaaacctattttcaggatcgacacgtcacacggaatggtgaccccgagccggtg
gtggatccctcgcaggattatatgctgatgctgggctacgagaatgccacgcacacggtc
ctgcgcttccgccgcaagctggacacatgcgacggcacacatgacatggccataacgaac
gacacgatgcgcctgctgtacatgtaccacgcacaggatccgccgcacggctctgtgcga
ccgggcaccctgccggacccggggcgtgccttccgcccctaccgccccatggtgctgatg
cagcgcgcccagctgccgatgccctcgccaacgcacgatgagcgcgtgcgagtcctggaa
ctgcgcaacgaggatgtggagctgcctggcggggacacgccgctcttctggtgcaagatg
ttcaagctggaggacatcaatcgcaagcaccacctgatccggtacgagccgatttatgat
tcatcgtccagcgtgcattacttgcagcacataacgctgcacgagtgccagggcgctcac
tcggagctggaggagatggcacgcgagcagggacgccagtgcatgggcgcccgatccata
ccgctggcatgcaatgccattgttgcctcctggtcgcggggcagcgagggctttacgtat
ccacacgaggctggctacccgatcgagtcgcgacaggccaaatattacttaatggagacc
cattacaacaatttaaagcccgactttgcccaattgcacgcccgacaaatggcggataat
tcgggtttgaaaatctactttacgcacgtcctgcgaccaaacgatgctggcatattgtca
atcggaatggaccccaactggcgacacattatcccgccgggccagaagcgcgtcttatcg
gagggccagtgcattgaggactgcaccgggtatgccttcccccagcagggcatcaacata
tttgcggtgatgatgcgcacccaccagatcggcaaggaggttaagttgcgccagatacga
caaaccgaggagctgccgccaattgcacacgacagcaatatagatgttgcctatcaggat
tttcgacgtttgccacaatcggtgcactccctgcccggggatagactcatcgccgaatgc
atttatgacagttcgtcacgaaaggcaattaccttgggtggcctcaccatgaaggaagaa
agctgcacagtgctgacactctactatccacgccagaagaagctgacaacgtgtcactca
ctaccgagtctgcccacagtgttgcattcgcttggcatcgaacaactggcaaccgactcg
aatcccgtgcttatatcatcgccacccgaattggccggaatgacactggaggcacgtctg
atatcctacgattgggaaaatcaatttggcgaattccaggaggccacacgcaaaggcagc
ttcaagcccatctgttggggggccaagaatcatgtggtgccgggctccgagttcctcgaa
ggctacagcattaatgttaccaagacctacaagaagcacaagcggtgcaagcccaagcgc
ctttttgtcccgattaccgagaggactgctccaccgccagcctccgatctgagtgagctt
cccgtcctccacgagctggacaacaacaacatcatcgagggagcggcgcggagtagccgc
agctcggcgaccgatgtccacggactaagtctgagccgtggcaactgccgggagttcgtc
agctgcctgctctggctgggagcctcctcctggtggctcctgctcatgctaaggacgtga

DBGET integrated database retrieval system