KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11749Help
Entry
Dpse_GA11749      CDS       T01032                                 

Definition
(RefSeq) GA11749 gene product from transcript GA11749-RA (EC:1.14.17.-)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 779 aa AA seqDB search
MSTWNKKSNHNYLLEFKQHKMAQSRKAQAAAAASAAAVALSYSISGEASSHRRPIASSPA
THSSSRRSSLITCFISCHTSSLLLLLLLLLLDGAQAVSRSSSGSGSGSNKTAAASGPNSG
GATPIWDHAIDLNEDFRILWQIINQDITFEIQARTLGYVGFGFSPDGNLAGADMAIGWVD
KGQTYFQDRHVTRNGDPEPVVDPSQDYMLMLGYENATHTVLRFRRKLDTCDGTHDMAITN
DTMRLLYMYHAQDPPHGSVRPGTLPDPGRAFRPYRPMVLMQRAQLPMPSPTHDERVRVLE
LRNEDVELPGGDTPLFWCKMFKLEDINRKHHLIRYEPIYDSSSSVHYLQHITLHECQGAH
SELEEMAREQGRQCMGARSIPLACNAIVASWSRGSEGFTYPHEAGYPIESRQAKYYLMET
HYNNLKPDFAQLHARQMADNSGLKIYFTHVLRPNDAGILSIGMDPNWRHIIPPGQKRVLS
EGQCIEDCTGYAFPQQGINIFAVMMRTHQIGKEVKLRQIRQTEELPPIAHDSNIDVAYQD
FRRLPQSVHSLPGDRLIAECIYDSSSRKAITLGGLTMKEESCTVLTLYYPRQKKLTTCHS
LPSLPTVLHSLGIEQLATDSNPVLISSPPELAGMTLEARLISYDWENQFGEFQEATRKGS
FKPICWGAKNHVVPGSEFLEGYSINVTKTYKKHKRCKPKRLFVPITERTAPPPASDLSEL
PVLHELDNNNIIEGAARSSRSSATDVHGLSLSRGNCREFVSCLLWLGASSWWLLLMLRT
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtggaacaagaaaagtaatcacaactatttgctagagttcaagcagcacaaa
atggcacaaagcagaaaagcacaggcagcagcagcggcatcggcagcggcagtggcactc
agctacagcatctctggagaagcatcatcacacagaagacccatcgcctcctctccagca
acacattcaagttcaaggcggtcatcgttaatcacatgttttatatcctgccacacgtcc
agcctcttgttgctgctcctcctgctgctcctcgatggagcccaggcagtcagtcgcagc
agcagcggcagcggcagcggcagcaacaaaacagcagcagcatctggacccaacagcggc
ggggcaacacccatttgggatcatgccatcgatttgaatgaggattttcgcatactctgg
caaatcattaatcaggatataacattcgaaatacaagcacgtacactcggctatgtcggc
ttcgggttctcgcccgatgggaatctggctggtgccgatatggccatcggttgggtggac
aagggtcaaacctattttcaggatcgacacgtcacacggaatggtgaccccgagccggtg
gtggatccctcgcaggattatatgctgatgctgggctacgagaatgccacgcacacggtc
ctgcgcttccgccgcaagctggacacatgcgacggcacacatgacatggccataacgaac
gacacgatgcgcctgctgtacatgtaccacgcacaggatccgccgcacggctctgtgcga
ccgggcaccctgccggacccggggcgtgccttccgcccctaccgccccatggtgctgatg
cagcgcgcccagctgccgatgccctcgccaacgcacgatgagcgcgtgcgagtcctggaa
ctgcgcaacgaggatgtggagctgcctggcggggacacgccgctcttctggtgcaagatg
ttcaagctggaggacatcaatcgcaagcaccacctgatccggtacgagccgatttatgat
tcatcgtccagcgtgcattacttgcagcacataacgctgcacgagtgccagggcgctcac
tcggagctggaggagatggcacgcgagcagggacgccagtgcatgggcgcccgatccata
ccgctggcatgcaatgccattgttgcctcctggtcgcggggcagcgagggctttacgtat
ccacacgaggctggctacccgatcgagtcgcgacaggccaaatattacttaatggagacc
cattacaacaatttaaagcccgactttgcccaattgcacgcccgacaaatggcggataat
tcgggtttgaaaatctactttacgcacgtcctgcgaccaaacgatgctggcatattgtca
atcggaatggaccccaactggcgacacattatcccgccgggccagaagcgcgtcttatcg
gagggccagtgcattgaggactgcaccgggtatgccttcccccagcagggcatcaacata
tttgcggtgatgatgcgcacccaccagatcggcaaggaggttaagttgcgccagatacga
caaaccgaggagctgccgccaattgcacacgacagcaatatagatgttgcctatcaggat
tttcgacgtttgccacaatcggtgcactccctgcccggggatagactcatcgccgaatgc
atttatgacagttcgtcacgaaaggcaattaccttgggtggcctcaccatgaaggaagaa
agctgcacagtgctgacactctactatccacgccagaagaagctgacaacgtgtcactca
ctaccgagtctgcccacagtgttgcattcgcttggcatcgaacaactggcaaccgactcg
aatcccgtgcttatatcatcgccacccgaattggccggaatgacactggaggcacgtctg
atatcctacgattgggaaaatcaatttggcgaattccaggaggccacacgcaaaggcagc
ttcaagcccatctgttggggggccaagaatcatgtggtgccgggctccgagttcctcgaa
ggctacagcattaatgttaccaagacctacaagaagcacaagcggtgcaagcccaagcgc
ctttttgtcccgattaccgagaggactgctccaccgccagcctccgatctgagtgagctt
cccgtcctccacgagctggacaacaacaacatcatcgagggagcggcgcggagtagccgc
agctcggcgaccgatgtccacggactaagtctgagccgtggcaactgccgggagttcgtc
agctgcctgctctggctgggagcctcctcctggtggctcctgctcatgctaaggacgtga

DBGET integrated database retrieval system