KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA12159Help
Entry
Dpse_GA12159      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08738  cytochrome c
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo01100  Metabolic pathways
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dpse_GA12159
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA12159
   04215 Apoptosis - multiple species
    Dpse_GA12159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 4816850
NCBI-ProteinID: XP_001356548
FlyBase: FBgn0072207
UniProt: Q29MT1
Position
4
AA seq 105 aa AA seqDB search
MGGGDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGV
VWSDSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggtgatgcagacaacggcaagaagatttttgtgcagaagtgcgcccagtgc
cacaccgtcgaatcgggaggcaagcacaaggttggccccaatctaagcggcattgtggga
cgcaaatccggctctgctccgggcttcaaatacacagatgctaatcaaaagaagggcgtt
gtttggagcgattcgacgctggacgagtacctcaaggatccaaagaaatacatacccggc
actaagatggttttcgcaggactcaaaaaggccgaagaccgtgccgatttgattgcatac
cttaaaaaaaataagtaa

DBGET integrated database retrieval system