KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA12236Help
Entry
Dpse_GA12236      CDS       T01032                                 

Definition
GA12236 gene product from transcript GA12236-RA (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dpse_GA12236
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dpse_GA12236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 303 aa AA seqDB search
MSEEIEVLVFGSAIIDFICYTPRLPKAGETLHGHKFQTGYGGKGANQCVAAARLGSRTAL
VAKLGDDSFGSDYLRQLREENVNVSHVQQLTGQSTGIAQIAVSDDGENNIIIVVGANNQL
SADDVFFAKALFGEAMVLVCQLETPVAATLQALRCFKGVSIVNAAPAMEQTPRELLELAN
IFCVNESEAAMMTGVASVSSIKEANDACKRLIEMGANTVILTLGPLGAVWGAKDSPGKFQ
HVPAPHVNKVVDTTGAGDAFIGALAHNLARFPDRTLDAHIAAACEVASQSVQLPGTQSSF
PRA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaaattgaggttctggtcttcggttcggccatcatagatttcatctgctac
acgccccgccttcccaaggccggggagacgcttcacggacacaaattccagaccggctac
ggcggtaagggtgcgaatcagtgtgtggcggccgccaggctgggctcaaggacggcattg
gttgccaaactaggcgacgatagctttggcagcgactaccttcgccagctgcgagaggag
aacgtcaatgtaagccacgtgcagcagctgacgggccagagcacgggcattgcccagatc
gcagtctccgacgatggcgagaacaacatcatcattgttgtgggtgccaataaccagctt
agcgccgacgacgttttctttgccaaggcactgtttggcgaggccatggtgctcgtgtgc
cagctggagacacccgtcgcagccacgctccaagccctgcgctgctttaagggtgtttct
attgtaaacgccgctccggcaatggagcagacgccacgagagctgctggagctggccaac
atattctgcgtgaacgaaagcgaggctgccatgatgacgggagtggccagcgtgagcagc
ataaaggaagctaacgacgcctgcaagcggctcattgaaatgggtgctaacacggtgatt
ctcacactgggccctctgggagctgtgtggggagccaaagattcgcccggcaaattccag
cacgtgcccgctcctcacgtcaacaaagtggtagacacaacgggcgcgggtgacgccttc
atcggtgcactagcccacaacctggcccgcttcccagatagaaccctcgacgcacacatt
gcggccgcctgtgaggtggcctcacagtctgtccagctgccagggacccaatcgagcttc
ccccgcgcttag

DBGET integrated database retrieval system