KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13119Help
Entry
Dpse_GA13119      CDS       T01032                                 

Definition
GA13119 gene product from transcript GA13119-RA (EC:3.1.3.-)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dpse_GA13119
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dpse_GA13119
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA13119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 600 aa AA seqDB search
MHCLQFVAFVVWCGGLIPGSWTATLQPPPLIQTLSAGSDIGPEFNLDAQQQRPLEKLEPE
DAEFWRSVGLKQLEKTIEQAKRAEEHSYAKKARNIIIFIGDGMGVSTISAGRIYKGQYLK
HGHGEEETLSFDNFPNTGMAKTYNVDKQVPDSAGTATALFTGIKTHYGAIGVDATRSKVD
AKLGRIETIMEWAQKEGKRTGIVTTTRITHATPAATYAHIYDRDWECETEVPAESVGIHV
DIARQLVENAPGNRFNVILGGGMSPMGILNATEVKRTKFEGPTETICSRRDQRNLPAEWL
AHHSMDKVPAALVHNRDDLLAVDAKNVDHLMGLFRNNHITYSIAREVGEPSLQEMTETAL
RVLERGDDSPGFVLLVEGGRIDQGHHMNYARAALHEVYEFDLAIQAALNMTDSDETLIVV
TADHSHAVTFNGYALRGNDILGASNLHEKADPMVYETISYANGPGYYDHLANESRPANSS
NMWMPLKLYTEEERQAPTYRHLASVPRKDETHGGEDVAVFASGPGSSLVRGVFEQNYVAY
VMSYAGCIGPAKDFDDSCEDREENKPINSSSSGSADNVLRAAILPILAAASAAFLRGRQL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcctccagttcgttgcttttgtcgtgtggtgcggtggcctgatcccagggagc
tggacggccaccctccagccaccgcccctgatccagaccctcagcgccggcagtgacatt
gggccagagttcaacctggacgcccagcagcagcgaccgctggagaaactggagccggaa
gatgctgaattctggcgcagtgtgggcttgaagcagctggagaagaccatcgagcaggcc
aagcgggccgaggagcactcgtacgcgaagaaggcccggaacatcataatcttcattggc
gatggcatgggcgtgtcgacgatcagtgcgggacgcatctacaagggccagtacctgaag
cacggccatggcgaggaggagacgctctcctttgacaactttcccaatactggaatggcc
aagacatacaacgtggacaaacaggtaccggactcggcaggcacggccacggcactgttt
accggaatcaagacgcactacggagccattggcgtggatgccactcgctccaaggtggat
gccaagctgggccggattgagactatcatggagtgggcccagaaggaaggcaagcgcacg
ggaatcgtgaccacaacgaggattacgcatgccacgcctgcggccacctacgcccacatc
tacgatcgcgactgggagtgcgaaacggaggtaccggccgaatcggtgggcatccatgtg
gacattgcccgccagctggtggagaatgccccaggcaacagattcaatgtaatcctgggc
ggtggcatgtcgcccatgggcatcctgaacgccaccgaggtgaagcggaccaaattcgag
ggccccaccgaaacgatctgcagtcgaagggatcagcgcaaccttccagccgagtggttg
gcgcaccattccatggacaaagtgccagcagcactggtacacaatcgggacgatctgctg
gctgtggatgcgaagaacgtggatcacctgatgggcctgtttaggaacaatcacatcacc
tactcgattgcccgggaggtgggcgaaccgtcgctgcaggagatgacggagacggctcta
cgggttctggaacgaggcgacgattcacctggatttgtgctcctcgtcgagggcgggcgc
atcgatcagggccaccacatgaactacgctcgggcggctctgcacgaggtgtacgagttc
gatctggccatccaggcggctctcaacatgaccgattccgacgagacgctcatcgtggtc
acggcggaccactcacatgccgtcaccttcaacggctatgcgctgcgcggcaacgacatc
ctgggcgcatcgaacctacacgagaaggccgatcccatggtctacgagaccatctcctat
gccaacgggcccggctactacgatcatttggccaacgaatcgcggcccgcgaacagctcc
aacatgtggatgcccctcaagctctacaccgaggaggagcgccaggcccccacctaccgc
cacctggcgtccgtgccgcgcaaggacgaaactcacggcggcgaggatgtggccgtgttc
gcctctgggcccggctccagcctggttcgcggcgtcttcgaacagaactatgtggcgtac
gtgatgagctatgccggctgcattggtccggccaaggactttgacgactcctgtgaggat
cgcgaagagaacaagccgatcaacagcagcagcagcggcagcgctgacaacgttttgcga
gcggccattcttccaattttggctgccgcctcagctgctttcctgcggggacgccaactg
taa

DBGET integrated database retrieval system