KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13194Help
Entry
Dpse_GA13194      CDS       T01032                                 

Definition
GA13194 gene product from transcript GA13194-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA13194
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 1340 aa AA seqDB search
MNHQARLSLSIMSPHHSNPIADSTRIDGSPVAHRHSPANLIHRTMSLERSQSTTNGTPGN
RTASSTTTMSRQKLNLSLMDPKTFADVHSSGLASRIVAYHNDSTLGGRRGLQRSISVSNL
YNPLKQPRRTPSSPLPYRPSPPSLSMTRIAPPERSFYCGSTLPGLLRSNSVVGVHKVCNN
EHEQLSRENRPILHPHPPQHESEPTRSVLEELKEISRKRINSGDTQKQHEIFKRSCHRIG
DFVDHHHHPPPATTFKRQRELSVAVPLRHHHAATMVPPLAPPTQTQHHPQPTEAVSPEQL
AKRRNCSYNNDIASSLSSSRRHVTKRKLYDMRESMRQTSMEGTANGSSPENSPSAPVSKM
QRKTDAEPIAIAKSMPIVGVPVVAPSRTISAPAMGQQHQINTELHRNTEVDLPLAASKPK
LTLFNTKQTQQVQEQTKHYDLESPDVDAGEYAGINFVKPKQQNSLSGVKNPSVERTHKTK
LAIMLSGLRGEIYQGEEEEPDEMDAPVSPKTPIKPIVLTTTKAVSPNTATKVSPSTITKT
TTTSSSDKPIILSDKVIAPAPGTGTATATATATTTMTNGLQPKLLFGQAPTPATATAAEG
ASPNESSKETPTAVNTAPTTSSSPAATPVLTFGSPKSTATVIGAPLKTTSVFAPTSSAQA
PVLSFGKAPPVDTATPFKLESNPTNKMNGIPTNGIATTSASTPAATASPAAMTFGSTITN
NAPSTAAFMFGKTEVSSAPAAAKPPVFSFGGSTAAAPTPTPTQTPTATATPSPATGTGTS
LFGNSFGSAFKQPEANKAATTVPEPAKPSAIIGVKPNFGGNSFGSAFKQPAATVTATAST
TAAEPTKAFSFTGTTNTAAATTSNLFSFGSAAVAKPAEPAPAPAPAPAPAPTSGNIFGQS
ATASTPALFSFGGAAAASASAAAPNTIKETKPAFAFGSDASATTAVQSNGSNSSGSNNLF
NFGAGVTSGAPPSFGGATSTNAPSKSAFSFSTAQKPTSQIGNNAAPTAAKPFAFGGGQPQ
VPGTTASTAGSAASPGGFSFVAAAGKKEAATSGASLFGTPNNASTGVKPSFSFGGSSNNQ
QPNNAATSTPSAGQQQQSAPGQPGAFSFAAVAKKETSGASIFGQPAAAAAATPSASIKPS
FSFGGSSNNTQNAPSAHVAAPSFGGFGAPAVPATSNQSKPFAFGGTTTAAPNATPAIGGN
LFANAVSAVQSQAKPGGFSFGGTTTKTNAPAPPGNAPFSFGGAAAGGMASPPSSQNVNTA
KPFSFGGGVSAFGSPSPSPVQAAAATNPGAGAFSFGSPAPPSASVAPGMSQQINAGNMFA
LPPSTSEQRPIRRATRRLQK
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcaggcgcgcttaagtttgagcatcatgtcaccgcatcacagcaatccgatt
gctgactctaccagaattgatgggagtccagtagctcatcgtcattcgccggcgaatctc
atacacagaactatgagtctcgaacggagccaaagcacaactaatggcaccccggggaac
cgcaccgcatcatcgacaacaacaatgtcgcgacagaaactgaacctcagtctgatggat
cccaaaacatttgcggatgtgcacagcagtggactggcctctcggattgttgcatatcat
aacgacagcaccttgggcggccgtcgtggccttcagcgcagcatatctgtgagcaatctg
tacaatccactgaagcagccaagaaggaccccgtcgtccccactgccgtacagaccatcg
ccaccgtcactgtccatgactcgaatcgcgccgccagagcgcagtttctactgcggcagc
acgctgcccggcctgctgcgttccaattcggtggtgggtgtccacaaggtgtgcaataat
gaacacgaacagttatcacgggaaaatcgccccatcctgcatccacatccaccgcagcat
gagagcgagcccaccaggagtgttctggaagaactcaaagagatctcccggaagcgtatc
aacagtggggacacacaaaagcagcacgagattttcaagaggagctgccatcgcattggc
gactttgtggaccatcatcaccatccgcctcccgcgacaactttcaaaaggcaacgagag
ctgagcgtggcagttccactgagacaccatcatgcggcgacaatggtgccaccgctggcg
ccgccgacacaaacgcagcatcacccgcagcccactgaggccgtttcaccggagcagctg
gcaaagcggcgcaactgtagctacaacaatgacatcgcctcctcgttgagttccagccgg
cggcacgtgaccaagcgcaagctgtacgacatgagggaaagcatgcggcagacgagcatg
gagggcactgccaacggcagctcgcccgagaactcccccagcgcaccagtgtccaagatg
cagcgcaagacagacgcagaacccatagccatagcaaagagtatgccgattgtaggagta
ccagtagtggcgccctcacgcaccatctcagcaccggctatgggacagcagcaccagata
aatacagaactacacaggaacaccgaggtggatctgccattggctgcctccaaaccgaaa
ctcacgcttttcaataccaagcaaacacagcaggtgcaagagcagaccaaacattacgat
cttgagagtcccgacgtggatgctggcgaatacgcgggcataaattttgtgaagcccaag
cagcagaactccttgagtggcgtcaagaatcccagcgtcgagcgcacacataaaacgaag
ctggccattatgctgagtggcctgcgcggcgagatctaccagggagaagaagaagaacca
gacgaaatggacgcccccgtcagtccaaagacacccatcaaaccgattgttctgacgaca
accaaagcggtatcacccaacacagcgaccaaagtcagcccctcgacaataaccaagacc
acgacaacgtccagcagtgacaagccaattatattgagtgacaaggtgatcgcaccagct
ccaggaacaggaacagcaacagcaacagccacagctaccacgactatgacaaatggtttg
cagccgaagcttctctttggccaagcaccaacaccagcgacagcgacagcggcagaaggg
gcatcacccaacgagtcatccaaagaaacgccaactgctgtcaacacagccccaacaaca
tcgagctcacctgcagccacaccagtactgacattcggaagtccaaaatccactgccacg
gttatcggggcccctttgaaaacaacatcagtctttgcccccacaagcagtgctcaagcg
cccgtactgtcatttggcaaagcgccgccagtagacactgcaacaccattcaaactggaa
agcaatcccacaaacaagatgaatggaataccaaccaatgggatagcaactacatcggcg
tctacacctgcagcgactgctagcccagcagcaatgaccttcggaagcaccatcacaaac
aatgcgccaagcacagccgcgtttatgtttggaaaaacagaggtgtccagcgcaccagca
gcagccaagcctcctgtctttagttttgggggcagtacagcagctgcaccaacaccaaca
ccaacacaaacaccaacagcaacagcaacaccatctccagcaacaggaacaggaacatct
ttgtttgggaacagctttggcagcgcatttaagcagcccgaagcgaacaaagccgccaca
acagttccagagccagcaaagccgtcagccataatcggagttaagccgaacttcggtggc
aacagttttggcagcgcattcaagcagcccgcagccacagtcacagccacagcctcaacc
acagctgcggagccaacaaaggcattcagtttcacgggaacaacgaacacagcggctgcg
accacatcaaacctcttttcgtttggaagtgcagcagtcgcaaagccagcagaaccggca
ccggcaccagcaccagcaccagcgccagcgcccacctcaggtaacatctttgggcagagt
gcaactgccagtacacccgcactgttttcttttggtggtgctgcagcagcatcagcatca
gcagcagcaccaaacaccatcaaggaaacaaagccagcatttgcattcggaagcgatgcc
agcgctacaacagctgtgcaatccaatggcagcaacagcagcggcagcaacaatttgttc
aacttcggtgcaggcgtcacgagtggagcccctccttcctttggcggcgccacatcgacc
aatgccccatcaaaaagtgccttcagcttcagtacagctcagaagccgacctctcagatc
ggcaataatgcagctccaacagccgcaaaaccatttgcatttggtggcggacagccacag
gtccctggaacaaccgcatccaccgctggctcagctgcatcgcccggaggattctccttt
gtggccgctgcagggaagaaggaggcagcaaccagtggagcgagtctttttggaacaccg
aacaacgccagcacaggcgttaagccgagctttagtttcggtggaagcagcaacaatcag
caacccaacaatgcggcaacctcaaccccctcagcagggcagcagcagcagtcggccccg
ggtcagccgggagcattctcctttgccgctgtcgccaagaaggagaccagtggcgccagc
atttttggccagcccgccgccgccgccgccgccacccccagcgcgtccatcaagccgagc
ttcagttttggtggcagcagcaacaacactcaaaatgcaccatcagcacatgttgcggcg
ccaagctttggcggatttggggcacctgccgtgcccgctactagcaatcaaagcaaaccc
tttgcatttggtggcaccacaaccgcggcgcccaatgccactcctgccataggcggcaac
ttgtttgccaatgcggtgagcgccgtgcagagccaggccaagccgggaggtttctcgttt
ggcggaacaacaaccaagaccaacgccccggcaccaccgggcaacgctccattctcgttc
ggaggagcggcagctggcggcatggcctctccgcccagcagccagaacgttaacacggcg
aagccgttcagctttggcggcggtgtcagtgctttcggaagccccagtccgtcgccggtt
caggctgcagcagccaccaatccaggagcaggcgccttcagtttcggtagccccgcccca
ccatcggcgagtgtggcgcccggcatgtctcagcaaatcaatgccggcaatatgttcgcc
ctgccgccgagcacttcggagcaacgccccatccgacgagccaccaggcggctgcagaag
tag

DBGET integrated database retrieval system