KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13324Help
Entry
Dpse_GA13324      CDS       T01032                                 

Definition
GA13324 gene product from transcript GA13324-RA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dpo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 185 aa AA seqDB search
MLRFNLIVAVSENFGIGLKGDLPWRLKSELKYFSRTTKRTSDPNKRNVVIMGRKTYFGVP
ASKRPLPERLNIVLSTTLKPAELPSDVVLCHSLEEAMKHLEEETLRDQIENVWIVGGSGV
YEEAMASSRCNRLYITKIQQNFECDTFFPSIPDSFREVPPDADTPVGVQEENGIKYEYKV
LEKRE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttaatctaattgtcgcggtgtccgagaacttcggcattggcttaaaggga
gatctgccatggcgcctaaaatccgagctgaagtattttagtcgcaccaccaagcgaacc
agcgatcccaacaaacgcaatgtggtaataatgggcagaaagacatattttggagtgccc
gccagcaagcgtccgctgccagagcgtttgaacattgttttgagcaccacgttgaagccc
gcagagcttcccagtgatgtggtcctgtgccacagcctagaggaagccatgaagcatctg
gaagaggagaccttgcgcgaccaaatcgagaacgtctggattgtgggcggtagtggagtt
tacgaggaagccatggcctcgtcccgttgcaaccggctgtacataaccaaaatccagcag
aatttcgagtgtgacaccttctttcccagtattccagacagctttcgtgaggtgccgccg
gatgcggacacacccgtaggcgtgcaggaggagaatggcattaagtatgagtacaaggtt
ttggaaaaacgagaataa

DBGET integrated database retrieval system