KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13337Help
Entry
Dpse_GA13337      CDS       T01032                                 

Definition
GA13337 gene product from transcript GA13337-RA (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dpse_GA13337
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA13337
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA13337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1133 aa AA seqDB search
MDTQDTQEVEIITSDLHQQQQQQQQQQQQLQNQNQQQNSPPQLPKFKNLIHPQLHAVGGV
TQLPNENGNVPPQQLLADSSSSSFTTMDTMTLDDENKEDQFRSETTFSYTVDNVGQLKSQ
RLSPPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKAESQPFT
RARIKHLFYSKENDYGYSNFITWQELQDSEKSYIHNNSITLEVHVIADAPHGVLWDSKKH
TGYVGLKNQGATCYMNSLLQTLYFTNSLRLAVYRIPTEADDSTKSVGLSLQRVFHELQFG
DRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTCLEGTIPGLFEGKMSS
YIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVASETLEGDNKYDAGVHGLQEAS
KGVIFTSFPPVLHLHLMRFQYDPITDSSIKYNDRFEFYEQINLDQYLAEGEKTSADYVLH
AVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIELNYGGMDDEISFHAKC
SNAYMLVYIRQSELDRVLGDIPESEISSDLVERLDLEKRIEMARRKERSEANLYVSVHVI
LEEYFESQQKRRLFDLEKTHQRPFKLKQTQTVDELVEMFVKGFGVSRNRMRIWNMCTAQT
QKFLYFDFEAEASRSIEQIPTSQKPWVIFLELASPNTSEPLAPFNPKSDVLLFLKYYDAK
NKRLNYIGCTQQPQSRRLIDLCPEVNRKLGFDLDTELTVFDEYGDKKIANLNDPIESVLY
LPQDNLQGQILIFEREIIDMKLDLPTVEDYFLDLVYRIEIIFSDKCNPNEPDFVLELSNR
YNYDQLTNAVAERLNTDPQKLQFFMCINSYKETAGNAVPYTFKGTVKDLVSYTKQSTPKR
IYYQRLSLSIHELDNKKQFKCIWVSNDLKEEKELVLYPNKNDNVKGLLEEAAKKITFLEN
SRKKLRLMKVSNHKIVAHCKDDTPLDTLLKANDSSITTTQSAQKIYRIEEVPADEMQLVE
NEYLLPVAHFSKELYNSFGVPFFTKARHGESYGALKQRIQKRLNVPDKEWENYKFTVINT
GLTTEVNDNDVINLENFRTSNSGQLPFLGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atggacacccaggatacccaagaggtcgagataatcactagcgatcttcaccagcagcaa
caacaacagcaacaacagcagcagcagctccagaatcaaaaccaacaacagaattcgccc
ccacagctgcccaaattcaaaaatctaatacacccacaattgcacgcagtcggtggagtc
acccagctgcccaacgagaacggcaacgtgccgccacaacaactgctggccgacagcagc
tcctcatcgtttaccacaatggacacaatgacgttggacgacgagaacaaggaggatcag
ttccgttcggagaccacattctcctatacggtggataatgtgggacaattgaaatcacag
cgtctgtcgccgccagtgtacgtacggatgctgccatggaagattatggtcataccgaac
gaccgcgcattgggcttctttctgcagtgcaacggggagaatgattcgcccacctggtcg
tgcaatgccattgccgaattgcgtctcaagtgccacaaggccgagtctcagcctttcacg
cgggcccgcatcaagcatttgttctactcgaaggagaacgactatgggtattcgaacttt
atcacttggcaggagctgcaggattcggagaagagctatatacacaacaacagcatcacc
ttggaggtgcatgtcatagccgatgccccgcatggtgttctctgggattcgaagaagcac
accggctatgtgggcctcaagaatcagggggccacctgctacatgaactccctgctgcag
acgctctactttaccaattcgctgcgcctggccgtctatcgcatacccacagaggccgac
gatagcaccaaatcggtgggcctctccctgcagcgtgtattccacgagctgcagttcggc
gatcgtccggtgggcaccaagaagctaaccaaatcctttggctgggagacactcgactct
ttcatgcagcacgatgtccaggagttcctacgcgttctgctcgacaagctcgagtcgaaa
atgaagggcacctgcctcgaggggaccataccggggctctttgaggggaaaatgtcatcg
tatatcaaatgcaagaatgtggactataacagcacacgctatgagaccttctacgatatc
cagctaaatatcaaagacaaaaagaacatttacgaatcatttcaggactatgtcgcctcc
gaaaccctcgagggtgacaacaaatacgatgctggcgtccatggcttacaggaggccagc
aagggcgtcatcttcacgtcattcccgcccgttctgcacttgcatttgatgcgtttccaa
tacgatcccattacggacagctcgatcaagtacaacgatcgtttcgagttctacgaacaa
atcaatctcgatcaatatctggccgagggcgagaagacatcagcggactatgtccttcat
gccgtgctggtgcattcgggcgacaatcatggcggacactatgtggtctttatcaatcca
aaggccgatgggcgctggttcaagtttgatgacgatgtggtctccagttgccgcaaacag
gaggccattgagctgaattatggcggcatggatgatgagatctcgttccatgccaaatgc
agcaatgcttatatgctggtgtacatcaggcagtcggaactggatcgtgtccttggcgat
atacctgagagtgagatatccagtgatctggtggagcgtctcgatctggagaagcgcatc
gagatggcgcgtcgcaaggagcgcagcgaagccaatctgtatgtgtcggtgcatgtcata
ctcgaggagtactttgagagtcaacagaagcgtcgtctcttcgacttggagaagacccat
cagcgtccgtttaagctcaagcagacccagaccgtcgacgaactggtcgaaatgttcgtc
aagggctttggcgtctcgcgcaatcgcatgcgcatttggaacatgtgcaccgcccagaca
caaaagtttctctatttcgactttgaggctgaggcatcgcgctccattgaacagataccc
acatcacagaagccatgggtgatcttcctcgagcttgcctccccgaacaccagcgaaccg
ctggcgcccttcaatcccaagtcagacgtgctgctcttcctcaagtattacgatgccaag
aacaagcgtctcaattatattggatgtacacagcagccgcagagccgacgcctcatcgat
ctgtgtccggaggttaaccgcaagctgggcttcgacctggacaccgagctgaccgtcttt
gatgagtatggcgacaagaagatcgccaatctgaatgatcccatcgagagtgtgctctat
ctgccgcaagacaatctacaggggcagatactcatctttgagcgtgagattattgacatg
aaactggatctgccaacggtggaggactactttctggatctggtctatcgcattgagatt
atattcagcgacaagtgtaatcccaatgaaccggactttgtcttggaattgtcgaatcgt
tataattacgatcagctaaccaatgcggtggccgagcgcctaaatacagatccgcagaag
ttgcagttctttatgtgcatcaacagctacaaggagacggcgggcaatgcagtgccctat
acattcaagggaacggtcaaggatctggtctcgtacaccaagcagagcacaccgaagcgc
atctattatcagcgtctttcgttgagcatccatgagctggacaacaagaagcaattcaag
tgcatttgggtgtccaacgatctgaaggaggagaaggagcttgtactctatccaaacaag
aatgacaacgttaaggggctgctggaggaggcggcaaagaagataaccttcctggagaat
agccgcaagaagctgcgtctgatgaaggttagcaatcataagattgtggcccactgcaag
gacgatacaccgctggatacgctgctcaaggcgaatgactcgtcgatcaccaccacacag
agtgcacagaaaatttatcgcatcgaggaggtgcccgcggatgagatgcagctggtcgag
aatgaatatctcttgccggttgctcatttcagcaaggagttgtacaactcgtttggcgta
cccttcttcaccaaggcgcgtcacggggagtcctatggggctctcaagcagcgcatccag
aagcgtctgaatgtccccgacaaggagtgggagaactacaagttcaccgtgatcaatacg
ggcctgaccaccgaggtgaacgacaacgatgtcatcaatttggagaatttccgcacctcg
aatagcggacagttgcccttccttggcctcgatcacatcaacaagtcacgcaagcgcagt
tcgctgaatttctccgaaaaggcgatcaaaatttacaattaa

DBGET integrated database retrieval system