KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13504Help
Entry
Dpse_GA13504      CDS       T01032                                 

Definition
GA13504 gene product from transcript GA13504-RA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dpse_GA13504
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dpse_GA13504
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dpse_GA13504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 201 aa AA seqDB search
MPSKEVVFYGLMAAIACVTTIVTHHRLAVQLFEMQWAQSVHSHTVLDTFHQRVDLRYFAG
HVLVIVNIASQCGLTGQQYAGLTQLLAKYGERGLRILNFPCNQFGQQMPQSDGQEMMDHL
RQEKANIGDVFAKIEVNGPGAAPLYKLLTRNRSNLRGGKIEWNFVKFLVDRRGHVYARYG
AQAEPSALSGDIERLLGEGSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcaaagaggtggtcttctatggcctaatggctgccattgcctgcgtgacgaca
atcgtcacccaccacagactggcggtgcagctgttcgagatgcagtgggcgcagtcggtg
cattcgcacacggtgctagatacgtttcaccagcgagtggatcttcggtactttgccgga
catgtgctggttatcgtgaacatcgcctcccagtgtggattgacggggcaacagtatgcg
ggcctgactcagctgctggcgaagtacggggagcggggcctgcgaatcctcaactttccc
tgcaaccagtttggccagcagatgccgcagtcggatggccaagagatgatggaccacctg
cgtcaggagaaggcgaatattggtgatgtctttgccaagatcgaggtgaatggacctggg
gccgcaccgctgtacaaactgctcacccgaaaccgcagcaacctgcggggcggaaagatc
gagtggaactttgtcaagtttctggtggatcgtaggggccacgtctatgctcgctacggg
gcccaagcggagccatctgcactttccggtgacattgagcggctgctgggtgaagggtcc
aaataa

DBGET integrated database retrieval system