KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13644Help
Entry
Dpse_GA13644      CDS       T01032                                 

Definition
(RefSeq) GA13644 gene product from transcript GA13644-RB (EC:2.3.1.48)
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dpse_GA13644
   04330 Notch signaling pathway
    Dpse_GA13644
   04350 TGF-beta signaling pathway
    Dpse_GA13644
   04630 Jak-STAT signaling pathway
    Dpse_GA13644
   04068 FoxO signaling pathway
    Dpse_GA13644
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA13644
Transcription factors [BR:dpo03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dpse_GA13644
Chromosome [BR:dpo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dpse_GA13644
Mitochondrial biogenesis [BR:dpo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dpse_GA13644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 3273 aa AA seqDB search
MMADHLDEPPTKRVKMDPTDISLFLEENLPDELVSSNSGWSDQLSGGGGGGASNVGVTNT
NSTGGGGGPQAVVGVGVGPNKQTGPGPGSGPGVGQVVVTSQMNGAGGGSQQPGSGGDDGS
GNSSSGGGGGGAGNQQQLRQMQQHQQQHQQQLQHLLQQQQQQQQQQQQGQKGTMVVPGMN
QLGSKSPNLQSPNQSVMQQVATQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMV
LTNSVGGGGMGGMVNQLKQQQPGGGMINAVSVAGGPGGPVGAGSGSVAPNQQGMHMQNGP
MMGRMVGQQHMLRGPHIMGAAGGGNGPGGPGNGPGGGGPRMQNPNMQMGQLNSMPYGVGQ
YGGPGGNNSQQQQQQQQQLLAQQMAQRGGVGVMPQGNRPVGTVVPMPSLGGDGTGGPTGQ
LVGGNPQQQQQMLGQQQQPGALGPRPPQPNQLLGHPQQQQQQPGTSQQQQQQGVQGVQVG
AAGGAVTAAVGGAGNPQANRQDVPDDRKRQIQQQLMLLLHAHKCNRRETLNPNREVCNVP
YCKAMKAVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCINSTCIICYPFRQSHSVFQNA
NVGGGGGAGSGGSTPGGGPPGSGGAGGLQQQQQNQPLTVLGGVGGSLDGKQQQQQQQVGA
PGGAQNTGLVMPQQQQQQQGGAPKSNAEMAQQLAQQQQQVQQQQQQHQQQQELRRFDAMG
QVGLSPVTAGNMIGGGAGVGAGQQQQQQGMPPSIRMQGIPPTVRVLGPTGPGSGSVLPND
VNSLQQQQQQMLQGQCNAANAGNRRRGGLSNMVDQQQQQQQQTNPAQQLGNIPTPLSVSV
GGFGSANFGGGAADKQQLVGQADQLSKLKVPQVHPPSGAGPGGATGVTAGGQGSSVLMPA
DTTGASGGNANANPNQNAAGGGGGAGGGGGTGGTGSTGNDSEKDWRESVTADLRNHLVHK
LVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKELEE
KRLKRKEQHQQMLMQQQGTGPVSGSGPVVVPGGGPVGVPGGVGGVPGSVSNPTVGGGLQG
VVGPQQQQQQTQQQQQSVGGVRPIISPMGGVMQPQQLRPQGPGGMVVGQQQQQPVGGGPV
GVAGLAGALGVGVGVGVGGQANMVTMRSHSPGGNMLTLQQQQRMQFPQQQQQQQAGNMLV
GPPGPSPGGMVVNPVLSPFQTAAGAANVLTSPVPGQQQQQQQQQQQQQQQFINANGGTVA
GSNPQLSEMMKQRHLHQQAAAGMLMPQSPFSNATAIQQQQQQQPNSNSFNSTMQQQQQKP
PGSVLNNMPPTPTSLDSALTTGGAGSGAAGSGGANGGGGSAGGVPSSAGGMTVSAPSPSP
GGGGGGFISNGPVGTPSNSSNTNTNSNTNNNSSSNSIINPPGSNCGSGSGSGSGSGSGSG
SVGGVGGVMATTTTTTTSATTPLSCNSSSSATATIASSGPGSGGSLSAPNSNPHMLATTS
SGGNGSGGSNQQQQQSQPSRMMSSSSSLSSQMAALEAAARDNDDDTPSPTNDTNGSGGGG
KASKGKLDSIKQEDEIKKEFMDDSCGGNNDSSQMDCSTGGKGKNVNNDGTSMIKMEIKSE
DADGDGNVKIKTEPMDVDESASSATHEGGGGGGKDDINGAHDGISGAGGMDIKTKIEPKP
LVPEPLALQAGDKKKKCQFNPEELRTALLPTLEKLLRQEPESVPFRYPVDPQALGIPDYF
EIVKKPMDLGTIRNNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFE
AEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNRYTFCQKCFNDIQG
DTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGF
VCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSEK
CVEVKPGMRRRFVEGGDMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTR
RVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCH
PTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPN
VLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAA
QRKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDL
MDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNNCKTAVETRYHC
TVCDDFDLCIVCKEKVGHPHKMEKLGFDIDDGCAPADHKQANPQEARKQSIQRCIQSLVH
ACQCRDANCRLPSCQKMQRVVQHTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVP
FCPNIKHKLKQQQLQQKLQQQQLLRRRVALMSRTAAPSALPGPAVSGPTVVAGGVPVVGM
ANVMPVGQAAVLLPGVGGHSPSAVPVPSPVSGSGMGGMTSPHPHQPGIGMKPGGGGGHPP
SPNVLQVVKQVQEEAARQQVPHGGGFGKGVPMAPPVMNRALVGGVGGVGGVPNQNVNQLG
VGMVGGVGVGVGGVSVGVGGVGVNLNQLGPGIGGGGNPSGGPLPGAGNCGNVLNANNLLS
MDQWRAGGGGAGVPQPRYVNNATGMRQPNQMMQQQQNVLQQQQQQQMMLTNPMGGGGVGG
GGQMPVGGQHGMGMGGMGTPMGAAGAGGVRPPPGGGGGQAAGSLNTHQLAQIMQKIKNNP
TNESNQHILTILKQNPQIMAAIIKQRQQTQINAGAVGGGAPGGGLQAGNGPQNPQQQQQQ
QQQQQQQQQQQQQQVMQQQQMQHMMNQQQQQQAGGPQQQQINPNQQQQQVNLMQPGAPHQ
RMPNMQQQNSAQMMLQNLPPGVTSQGGMVPNQNWNKMRYVPMNQYPPPYSQRQRGPHMGG
AVGQQQQQFPGGGGAGNFNAGGGAGAVGVPGGVAGGGGGGSGGPGADQYSMANAAVVAAA
SNILQQGQGGAGVGVGVGVGVKPGPGQQQHQQQQMGVLPPGMQQQQQQPLQQQMMQQVSM
PNAPNAQQNPAVVGPGGGPGSQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPS
PRAGPSASPRAQPSPHHVMSSHSPAPQGPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVG
VGVGVNVGNLNVGNAGGALPDASDQLTKFVERL
NT seq 9822 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggatcatttggacgagccgcccacaaagcgggttaaaatggatccaacggat
atctcgttgtttctggaagagaatctgcccgacgagctggtgtcctcaaacagcggctgg
tcggatcagctgagtggcggcggcggcggtggcgcctcgaatgttggcgtcacaaacaca
aactcaacaggcggcggcggcggaccacaagccgtcgtcggcgtcggagtcggaccaaac
aaacagacaggccctggccctggctctgggccaggagtcggtcaggttgtcgttacctca
caaatgaacggagccggcggtggctcccagcagcctggcagcggcggcgacgacggcagc
ggcaacagcagcagcggaggcggcggcggaggagcgggcaaccagcagcagctccgccaa
atgcagcagcatcagcagcagcaccagcagcagctgcagcacctactccagcagcagcag
caacagcaacagcagcagcagcagggccagaaggggaccatggtggtgccggggatgaac
caattgggcagcaaatccccaaatctgcagtcgcccaatcagagcgtcatgcagcaggtt
gccacacagatgggcatggtaaattcgatgcccatgtcgatatcgaataatggaaacaat
ggcatgaatgccataccaggaatgaacacaatcgcccaagggaatctggggaacatggtc
ctcaccaacagcgtcggcggcggcggcatgggtggcatggtcaaccagctgaagcagcag
cagccaggcggtggcatgatcaatgccgtttcagtggcaggcggacccggaggccccgtg
ggcgctggcagcggctcagtggcacccaaccagcagggcatgcacatgcaaaacggtccg
atgatgggtcgcatggtcggccagcagcatatgctgcgcggtccccacataatgggcgct
gccggaggtggcaatggaccaggcggcccagggaatggacccggcggcggaggaccacgc
atgcagaatcccaacatgcagatgggacaactgaatagcatgccctacggcgtgggccag
tacggaggtccgggcggcaacaattcccagcagcaacagcaacagcagcagcagctgctt
gcccagcagatggcacaacggggaggagtcggtgtcatgccgcagggcaatcgcccagtg
ggcactgttgtcccgatgcccagtttgggcggcgatggcactggcggacccaccggacag
ctagtgggcggcaatccccagcagcagcagcagatgctcggacagcagcagcagccgggt
gcccttggacctcgtcccccgcagccgaaccaattactgggccatccgcagcagcagcag
cagcagccaggaacctcacagcagcagcagcagcagggagtccagggtgtccaggtggga
gcagcaggcggagctgtgacagcagcagtcggaggagcgggaaatccacaggcgaaccgc
caggatgtccccgacgaccgcaagcgacagatccagcagcagctgatgctcctgctgcac
gcgcacaagtgcaaccggcgggagaccctcaatccgaaccgcgaggtctgcaacgtaccc
tactgcaaggcgatgaaggcggttctggcgcacatgggtacctgcaagcagagcaaggac
tgcaccatgcagcactgtgcttcctcgcgccagatcctcctgcattacaagacctgcatc
aacagcacctgcatcatctgctatccgttccgccagagtcattcggtgttccagaacgcc
aatgtcggaggcggcggaggagcgggaagcggtggttcgacccctggcgggggcccacca
ggcagcggaggggccggcggtctccagcaacagcaacagaaccaacctctcaccgtgctc
ggtggcgtcgggggatcactcgatggcaagcagcagcagcagcagcaacaggtaggagcc
ccaggaggagcccagaatacgggcctcgtgatgccccagcagcagcagcagcagcagggc
ggtgcacccaaatccaacgccgaaatggcccaacaactcgcccagcagcagcagcaagtc
cagcagcaacagcaacagcaccaacagcagcaggagctgcgacgcttcgatgccatgggc
caggtgggactctctcccgtaacggccggcaatatgatcggcggtggcgcgggtgtcgga
gcgggccagcagcagcagcagcaggggatgcctccgagcattcgaatgcagggcatccca
cctacagtgcgagtcctgggacccacgggtcccggttccggttccgtcctgcccaacgat
gtgaatagcctccagcagcagcagcagcagatgctccagggccagtgcaatgccgccaat
gctggcaatcggcgacgcggtggcctctccaacatggtcgaccagcagcaacagcagcag
cagcagacgaatcccgcacagcagttgggaaacattcccacgccgctgtctgtgagcgtc
ggaggcttcggcagcgccaactttggcggaggagcggcagacaagcagcagctggtgggg
caggcggatcagctgtcgaagctgaaggtgccccaagttcatcccccaagtggcgcagga
cctggtggtgcgactggcgtgactgccggcggccagggttccagtgttctgatgcccgcc
gatacgacgggtgccagcggggggaatgcgaacgcgaatcccaatcagaatgcggctgga
ggcggcggtggtgccggaggaggcggcgggacaggaggaacgggttccacaggcaacgac
agcgaaaaggactggcgggagtcggtgacggcggatctgcggaaccatctcgtccacaag
cttgtgcaggccatctttcccacctccgatccaacgacgatgcaggacaagcggatgcac
aacctcgtctcctacgcggagaaggtcgagaaggacatgtacgagatggccaagagccgc
tccgaatactaccacctgctcgctgagaagatctacaagatccagaaggagctcgaggag
aagcggctgaagcgcaaggagcagcaccagcagatgctcatgcagcagcagggcacgggc
cccgtatccggttcgggtcccgtggtcgttcccggcggcggccccgttggagtgccagga
ggcgtgggcggagtacccggctccgtctccaatcctacggtgggcggtggcctgcagggc
gtcgtcgggccgcaacaacagcagcaacaaacccagcagcagcagcaatccgttggcgga
gtccgtcccatcatcagtccaatggggggcgtgatgcagccacagcagctccgtccccag
ggtcctggcggcatggtcgtcggtcagcagcagcagcagccagtgggtggcggccccgtg
ggtgtcgcaggactggcaggagcactcggtgttggcgttggagtcggcgttggaggccag
gcgaatatggtgacgatgcgtagccactcgcccggcggcaacatgctcacgttgcaacag
cagcagcgcatgcaattcccgcaacagcagcaacagcagcaggctggtaacatgctggtg
ggtcctccgggacccagtcccggcggcatggtagtcaatcccgtgctctcccccttccag
acggccgctggagcggccaatgtcctcaccagtccagtgcctggccaacagcagcagcag
cagcagcaacaacagcagcagcagcagcagttcatcaacgcaaatggcggcaccgtagcg
ggcagcaatccccagcttagcgaaatgatgaagcagcgacacctccaccagcaggcggca
gcgggcatgctcatgccccagtcacccttcagcaatgccacggccattcaacagcagcag
cagcagcagccgaacagcaacagcttcaactctaccatgcagcaacagcagcagaagccg
cctggaagtgtcctcaacaacatgccaccgacacccacgagcctcgattcagccttgact
acaggaggggcaggatctggtgcggcgggtagtggaggtgcgaatggaggaggaggatca
gcaggaggtgtaccctcgagtgcgggtggaatgacggtttcagcgcccagtccctccccc
ggcggcggcggtggaggattcatctccaatggtcccgtcggcactccctccaacagcagc
aacaccaacaccaacagcaacaccaacaacaacagcagcagcaacagcatcatcaatccc
ccgggaagcaactgcggcagcggcagcgggagcggcagtggcagtggcagtgggagcggc
agtgtgggaggagttggaggcgttatggccaccacaacgaccacgacgacgtcggcaacg
acgccgctcagctgcaattcctcctcgtcggcgacggcaacgattgcatcgagcggaccg
ggcagcggaggctctctttcggcgccgaacagcaatccccacatgctggcaacgacctcc
tccggtggcaatggtagtggcggcagcaaccagcagcagcagcagtcacagccgagccgc
atgatgagcagctcgagcagcctatcctcccaaatggccgccttggaggcagcggcgcgt
gataacgacgacgacaccccatcgcccacgaacgacacaaacggcagcgggggcggcggc
aaggcttcgaaggggaagctggactcgatcaagcaggaggacgagatcaagaaggagttc
atggatgacagctgcggcggcaacaacgacagctcccagatggactgctccacgggcggc
aagggcaagaatgtcaacaacgacggcaccagcatgatcaaaatggagatcaaatcggag
gacgccgacggcgatggcaatgtcaagatcaagaccgagcccatggatgtcgacgagagt
gcctcatcggccacacacgaaggcggcggcggtggcggcaaggatgatatcaacggtgcc
cacgatggcatctccggagcggggggcatggacatcaagaccaagatcgagccaaagccc
ctggtcccagagccactggccctgcaggctggcgacaagaagaagaaatgccaattcaat
ccggaggagctgcgcaccgcattgctgccaacgttggagaaattgctgcgccaggagccg
gaatcggtgccgtttcggtatccggtggatccacaggcgctgggcatacccgactacttt
gagatcgttaagaagccgatggatctgggcacgatacggaacaacatccagaacggcaag
tacagcgatccctgggagtacgtggacgatgtttggctgatgttcgacaatgcgtggctc
tacaatcgcaagacctcacgcgtctaccgctactgtaccaagctttcggaggtgttcgag
gcagagatcgatccagtgatgcaagccctgggctactgttgcggcaggaaatacaccttc
aatccccaagtgctgtgctgctatggcaagcagctgtgcacgataccgcgcgacgctaag
tactatagctaccagaacagatacaccttctgccaaaagtgctttaatgacatccaggga
gacacggtcacactgggtgacgatccgttgcagtcacaaacacaaatcaaaaaggaccaa
ttcaaggagatgaagaacgatcacctggagctggagccttttgtgaactgccaggaatgc
ggccgcaagcagcatcagatctgtgtcctctggctggactccatctggccgggcggcttt
gtctgcgacaattgcctcaagaagaagaactcgaagcggaaggagaacaaattcaatgcc
aagcgcctgcccaccaccaagctcggcgtctacatcgagacgcgcgtgaataacttcctc
aagaagaaggaggcgggagcgggcgaggtgcacatacgcgtagtcagctcctcggagaag
tgcgtcgaggtgaagccgggaatgcggcgacgctttgtcgagggcggggacatgatgaac
gagttcccgtaccgggcgaaggccctgttcgccttcgaggaggtggacggcatcgatgtc
tgcttctttggcatgcacgtgcaggagtacggatccgagtgtccggcgcccaacacacga
cgcgtctacattgcctacctcgattcggtgcacttcttccggccgcgccaataccgtacc
gcggtctaccacgagatcctgctcgggtacatggactatgtgaagcagctgggctacacg
atggcccatatttgggcgtgtccgccatcggagggggacgactacatcttccactgccat
ccgacggaccagaagataccgaagccgaagcgcctgcaggagtggtacaagaagatgctg
gacaagggcatgatcgagcgcatcatccaggactacaaggacatactcaagcaggcgatg
gaggacaagctgggctctgccgccgagctgccctacttcgagggcgatttctggccaaat
gtccttgaagagagcatcaaggagctcgaccaagaggaggaggagaagcgcaaacaggca
gaggcagccgaggcagctgcagcggcgaatctcttctccatcgaggacaacgaggtgagt
ggcgatggcaagaagaagggccagaagaaggccaagaagtccaacaagtcaaaggccgcc
cagcggaagaacagcaagaagtccaacgagcatcagtcggggaatgatctctccgcgaag
atctatgccacgatggagaagcacaaggaagtctttttcgtgatacgcctgcactcggca
cagtctgctgccagtttagcgcccattcaagaccccgatccattgctaacctgcgatctg
atggacggccgcgatgcattcctcacgctggcccgcgacaagcactttgagttctcgtcg
ctgcggcgcgcacaattctcgacgctctcaatgctgtacgagctgcacaatcagggccag
gacaagttcgtgtacacgtgcaacaattgcaagacggccgttgagacgcgctatcattgc
accgtctgtgatgactttgatctgtgcattgtgtgcaaggagaaggtcggacatccccat
aaaatggagaagcttggcttcgacattgacgacggctgtgcaccggcggaccacaagcag
gccaatccccaggaggcccgcaaacagtccatccagcggtgcatccagtccctggtgcac
gcctgccagtgccgcgacgccaactgtcgcctgccctcgtgccagaagatgcagcgcgtc
gtccagcacacaaagaactgcaagcgaaagacgaacggtggctgccccatctgcaagcag
ctaatcgccctctgctgctaccatgcgaagcactgtcaggagcagaagtgtcccgtgcct
ttctgtccgaacatcaagcacaagctgaagcagcaacagctccagcagaaactccaacag
caacagctactgcgtcgccgtgtggctctcatgtcgcggacagccgctccttcggcactg
cccggaccggcggttagcgggcctacagtcgtcgctggcggtgtgcccgttgtgggcatg
gccaatgtgatgcccgtcggtcaggcggccgtgctgctgccaggagtgggcggacattca
ccgtctgctgtgccagtgccttcgccagtgtctggcagcggaatgggtggcatgacctcg
ccgcatccccatcagccgggcatcggcatgaagcccggaggtgggggcggacacccgccg
tcgccgaatgtcctgcaggtggtaaagcaggtgcaggaggaggccgctcgccagcaggtg
ccgcatggcggtggctttgggaaaggcgtcccaatggccccgcccgtcatgaaccgtgct
ctggtcggaggagtcggaggcgtcggaggagtacccaaccagaatgtgaatcagctggga
gtgggtatggtcggtggagtgggcgtcggagttggaggtgttagtgtcggtgtcggaggc
gtcggagtgaatctgaatcagctgggacctggcatcggcggcggtggcaatccctcgggc
ggccccctgcccggtgccggcaactgcggcaatgtcttgaatgccaacaacctgctttcc
atggaccagtggcgcgccggcggtggaggtgcgggtgtgccccagccgcggtacgtgaac
aacgccacgggaatgcgccagccgaaccaaatgatgcagcagcagcagaacgtcctccag
cagcagcagcagcagcagatgatgctgaccaacccgatgggcggaggaggggtcggcggc
ggcggccagatgcccgtcggcggacagcatggcatgggtatgggcggaatgggtacgccg
atgggagcggccggtgccggaggcgtgcgtccaccgcccggaggaggcggtggccaggca
gccggaagtttgaacacgcaccagctggcccagatcatgcaaaagataaagaacaacccc
accaacgagagcaaccagcacatcctcaccatcctcaagcagaatccccagatcatggcg
gccatcatcaagcagcgccagcagacacagatcaatgcaggcgccgtaggcggtggtgca
cccggtggtggcctccaagcgggcaatggaccccagaatccccagcagcaacagcagcag
cagcagcaacaacaacaacaacagcaacagcaacaacagcaggtcatgcaacagcagcag
atgcagcacatgatgaaccagcagcagcagcagcaggcgggcggcccccagcaacagcag
ataaatcccaaccagcagcagcagcaagtgaatctgatgcagccgggtgcaccccaccag
cggatgcccaatatgcagcagcagaactctgcccaaatgatgctccagaacctgccaccg
ggcgtcacctctcagggaggaatggtgccgaaccagaactggaacaagatgcgctacgtg
ccaatgaaccaatacccgcctccctattcgcaacggcagcgcggcccgcacatgggcgga
gcggtgggccagcagcagcagcagttcccgggcggcggcggagcgggcaactttaatgct
ggcggcggggcaggagccgtgggagtgcctggcggtgtggctgggggcggcggcggaggc
tcaggtggccccggagcggatcagtactcaatggcgaatgcggctgtggtggcggcagcg
tccaacatcctgcagcagggccaaggcggagccggtgtgggagtcggagtgggagtgggc
gtgaagccagggcccggccagcagcagcatcagcagcagcagatgggcgtgttgccgccg
ggtatgcagcaacagcagcaacaaccccttcagcagcagatgatgcaacaggtgtcgatg
ccaaatgccccgaatgcccagcagaatcccgccgttgtgggtcctggaggaggtcctggc
tcccaggtgatgggaccccccacgccgcactccctccaacagcagctaatgcagtccgcg
cgctcctctccgcccatccgctcgccgcagccgacgccttcgccccgctcagcgccgtcg
ccacgcgcggggccatccgcctcgccgcgggcccaaccctcgccccaccacgtcatgagc
agccactcgccagcacctcagggcccacacgacggcatgcacaaccacgggatgcaccac
cagtcaccgctacccggtgtcccccaggacgtcggtgtgggcgtaggcgtcggcgttggc
gtcggtgtgggcgtaaacgttggcaacttaaatgtcggcaatgccggcggagccctaccc
gatgcctctgatcagctaacgaaatttgtggagcggctctag

DBGET integrated database retrieval system