KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13723Help
Entry
Dpse_GA13723      CDS       T01032                                 

Definition
GA13723 gene product from transcript GA13723-RA (EC:2.3.1.-)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA13723
Transfer RNA biogenesis [BR:dpo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dpse_GA13723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 550 aa AA seqDB search
MKPKKKLGVGLSREERQVLVVGEIIQELLAAHEAKKDVNLNRMKSLISSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFVQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHLSDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVAHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
DIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPKLKGDCSIVRELHVY
GSVVPVNARDPTKFQHQGFGILLMEEAERIAVEEHGSRKLAVISGVGTRNYYRKLGYALD
GPYMSKILSE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaaaaagaagttgggtgttggtctcagtcgtgaggagcgtcaggtgcttgtt
gtcggggaaataattcaagagcttctggccgcacacgaagccaagaaggatgtgaatttg
aaccgcatgaagtcgcttatatcttccaaatatggactagacagctcgccacgattggtg
gacataatagccgcagtgccacaggacgccaaaaagatccttctgcccaaactgcgcgcc
aagcccatacgtacagcgagcggtattgccgtcgttgcagttatgtgcaagccccatcgt
tgtcctcacatcaatatgaccggcaacatctgcgtctattgtcctggcgggcctgacagc
gactttgagtactcgacgcaatcatataccggctatgagcccacctccatgcgcgctata
cgagcacggtacgatccctttgtgcagacgcgccatcgcgtcgaacagctcaagcagctg
ggtcatagcgtggacaaggtggagtttattgtaatgggcggtaccttcatgtgtctgtcg
gaggagtatcgcgactatttcatacgcaatctgcacgacgctctctctggtcacagcagt
gccaacgtggccgaggctgtacgttactctgagaaatctcgcaccaagtgcattggcatt
acaattgagacacgtccggactactgcctcaagaggcacctctcggatatgctcaactac
ggctgcacccgcctggaaattggcgtgcaatccgtctacgaagatgttgccagagacaca
aatcgtggccatacggtgcgggctgtgtgcgaaagttttcagctaggcaaagacgccggc
tacaagattgtggcccacatgatgcccgacttacccaatgtagactttgagcgtgacatt
gagcagttcatcgaatactttgagaatcctgcctttcgttcggatggcctgaaaatctat
cccactcttgtcattcgcggtaccgggctttatgagctgtggaagaccggacgctacaag
tcctatccaccctctatgctggtggatctggttgccaaaatcctggccctagtgccaccc
tggacacgagtctaccgcgtgcagcgcgacattcccatgccgttggtcagctctggggta
gagcacggtaatcttcgagagcttgccctggctcgcatgaaggatctgggtaccacatgt
cgtgatgtaaggacacgcgaggtcggcattcaggagattcacaacaaagttcgaccctat
gacatagagctaatccgacgcgattatgtggcaaatggaggttgggaaacgttcctctcg
tatgaggatcccgaacaggatatacttgttggtctactgcgtctgcgcaaatgttcgcca
gataccttccggccgaagctgaagggcgactgttccattgtgcgggaattgcacgtttat
ggctcggtagttccggtgaacgctcgtgatcccacaaagttccagcatcagggattcggt
atactgctgatggaagaggcggagcgaattgcagtcgaagagcatggcagccgcaagctg
gcggtcatctcgggtgtcggcactaggaactattaccggaagctgggctacgcgctggac
ggaccctacatgtcgaagatcctatcagaatga

DBGET integrated database retrieval system