KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13929Help
Entry
Dpse_GA13929      CDS       T01032                                 

Definition
GA13929 gene product from transcript GA13929-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dpo00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dpo00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dpo04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 350 aa AA seqDB search
MNGRSIRINRVPATIFAILLTIVLVYFLNFHQEERPAIYGKLRSDNPNRVNLRKMLIAAI
QASQRGGLEVLDVARSRQLKVRSKGQTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVRIF
SEEDKEHCKESHSYDLDPTVLHETAQVPDVSVNAQDVTVWVDPLDATKEFTEELYEYVTT
MVCVAVAGRPVIGVIHSPFNGQTAWAWVGNSMSEYLAGLHPPHGQENELPIITVSRSHTA
GAKDLARGIFGEQVNLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAILHALGG
TMTTLNDQLIRYGPDESPVNTEGLLATLEKHDKYMDQLVKYRTAHNGQLT
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgctccatacgcatcaatcgggtgccagccaccattttcgccatcctgctg
accattgtgctggtctactttctgaacttccaccaggaggagcggccggccatctatggc
aagctgcgcagcgacaatcccaaccgggtgaacctgcgcaagatgctgatcgccgccatc
caggcttcgcagcgcggcggtctcgaggtgctcgacgtggctcgctcccggcagctgaaa
gtgcggagcaagggccaaacggacgaaggcgtaaacgatccgtttaccgatgccgacggt
cgttcgcactgcgtcatgaagcagggcctgcagcgcatatttccacgtgtccgcatattc
tcagaggaggacaaggagcactgcaaagagtcgcacagctacgatctggatcccacggtc
ctgcatgagaccgcccaggtgccggacgtgtctgtcaatgcccaggatgtcacagtctgg
gtggatcctttggatgctaccaaggagtttactgaggagctgtacgagtatgtcaccacc
atggtgtgcgtggccgtggccggtcgtcccgtgattggggttatccacagcccctttaat
ggccagactgcatgggcctgggtgggtaactccatgtccgaatatctcgcaggacttcat
ccgccgcatggccaggagaatgagttgcccatcatcaccgtttcgcgctcgcacaccgcc
ggtgccaaggatctagcccgcggcatctttggggagcaggtcaatctgctgacggccgcc
ggggccgggtacaaggtgctccaggtggtggctaacaatgcgaccgcctacctgcacacc
tcaaagatcaagaagtgggatatctgtgccggagatgccatactgcacgccctgggcggc
accatgaccactctcaacgaccaactgatccgctacggcccggatgagtcgccggttaac
acggagggactgctggccactctggagaagcacgacaagtacatggaccagctggtcaag
taccgcactgcgcacaacggccagctaacgtag

DBGET integrated database retrieval system