KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13960Help
Entry
Dpse_GA13960      CDS       T01032                                 

Definition
GA13960 gene product from transcript GA13960-RA (EC:2.7.11.-)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA13960
   04068 FoxO signaling pathway
    Dpse_GA13960
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dpse_GA13960
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dpse_GA13960
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dpse_GA13960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAAQVAPTPPFKTPSGTETHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTNLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLASMFADKVED
SNQPVDEPRAMAIFELLDYIVNEPPPKLEHETFSSEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaacctggtgctgccgccggtgaatacggaggcaactgttgca
gccgcacaagtggctccaacgccgccatttaaaacaccatcgggcacagaaacacatagc
ctgctgggaaagccaaaaacgagcattgatgcgttaactgagactctagaaggactggac
atggacgacacggagcgcaagcggataaaagtgttccttagccagaaggagaagattggc
gaactttcggacgaggacctggagaagctgggcgaactgggctccgggaacggcggcgta
gtcatgaaagtccgacacacgcacacaaacctgataatggcgaggaagctgattcatctg
gaggtgaagccggccatcaagaagcaaattctacgcgaactaaaggtcctacacgagtgc
aacttcccacacattgtcggcttctatggcgccttctacagcgacggtgagattagcata
tgcatggagtacatggacggtggctcactcgatctcatactgaagcgggccggtagaata
cccgagtcgatcctgggacgtatcacgctcgccgttctgaaaggccttagttatctgcgg
gacaagcacgccatcatccaccgggatgtgaagccgagcaacatcctggtcaatagcagc
ggagagataaagatctgtgatttcggagtgtctggccagctgattgactcaatggccaac
tcgtttgtgggcacgcgcagctacatgtcaccggaacgtctgcagggcactcactactca
gtacagtcggacatttggtcgctgggactgtcgctggtggagatggccatcggcatgtat
ccgataccgccgccaaacaccgccactttagcgtctatgtttgccgacaaagtcgaggat
agcaatcagcccgtagatgagccgagggcgatggccatcttcgagctgctcgactatata
gtaaatgaaccgccacccaagctggagcatgagacattctcaagcgagttcaaggacttt
gtcgacatctgcctcaagaagcagcccgacgagcgggccgatctcaagactctgctgagt
catccgtggatacgcaaggcggaggtggaggaggtggatatatcaggatgggtgtgtaag
acaatggacctgccgccgtcgacaccaaaacgcaatacttcgcccaactaa

DBGET integrated database retrieval system