KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14457Help
Entry
Dpse_GA14457      CDS       T01032                                 

Definition
(RefSeq) GA14457 gene product from transcript GA14457-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA14457
   00053 Ascorbate and aldarate metabolism
    Dpse_GA14457
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA14457
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA14457
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA14457
   00982 Drug metabolism - cytochrome P450
    Dpse_GA14457
   00983 Drug metabolism - other enzymes
    Dpse_GA14457
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA14457
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA14457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 520 aa AA seqDB search
MCSSLLTVVLLGLTLAHTGVEVNADPPLKILGLFPHPGVSHFHFFHPIMRGLAEAGHDVS
VVSHFPDKHPAVHYKDYPLTGIDKLTNSVDLKVFEKRTFYSHFQEFFLLYDWGRQACNFT
LRSDALQQILKRRQGYFDVIIMEQFNTDCMMGVAHQLHAPVIALSSCVMMPWHYERMGAP
IIPSHIPNLFMAQSQDMNFGGRLANWFSFHALNWMYKLLSVPAADKMVQYKFGHMVPSVG
ELAKNTSLFFVNQHYSLSGPKPLPPNVIELGGIHIQKSKPLPADLQRLLDNAEHGVILIS
WGSMIRANSLSAAKRDGIVRAAARLKQQVIWKWENETLPNQPANMHIMKWLPQRDILCHP
NVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVQRGMATILNYEEIGENSVI
RALKKALDKKYYDAAKAVSHSYNHRPQQALQTALWWVEHVAHTGGAPLLQPSAVHMSRFV
YYSLDCYAVVALLLAIIIGSWLALIRRCCGSKSSAKPKRD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgtcgctgctcaccgtagtgctgttggggctgaccctggcccataccggggtc
gaggtcaatgccgatcccccgttaaagatattgggtctctttccccatcccggcgtcagt
cacttccacttcttccatcccatcatgcggggtctggccgaggcgggacatgatgtcagt
gtggtctcacactttccggacaaacatccggccgtacactacaaggattaccctctaaca
gggatagacaagctcacaaacagcgtggatttgaaggtctttgaaaaacgcactttctac
agtcacttccaggagttcttcctactgtacgattgggggaggcaggcctgcaacttcact
ctccgctcggacgcactgcagcagatcctcaagcggaggcagggctactttgatgtgatc
ataatggagcagttcaacacggactgcatgatgggagtggcccaccagctgcatgcgccg
gtgatagctttgagcagctgcgtcatgatgccctggcactatgagagaatgggtgctccg
ataataccctcccacataccgaacttgttcatggcccagtcgcaggacatgaattttggg
ggacgactggccaattggttcagtttccatgccctcaactggatgtacaaattactctcc
gtacccgctgccgataagatggtgcaatacaagtttggccacatggttccctccgtgggt
gagctggccaagaatacctctttgttcttcgtgaaccagcactactccctgagtggaccc
aagccactgccccccaacgtgatcgagctgggcggcatacatatacaaaagtcgaagccc
ttgcccgcggatctgcagcggctcctggacaacgccgagcatggggtgattctcattagt
tggggctccatgatacgcgccaattccctgtccgctgccaagcgggatggcatagtacgg
gccgcggcacgcctgaagcaacaggtcatctggaaatgggagaacgagacgctgccgaac
caacccgccaatatgcacatcatgaagtggctcccacagcgcgatatcctgtgccatccc
aatgtcaaagtctttatgtcccatggcggtctcatgggcacctcggaggcggcctactgc
ggtgtacccgtcgtggccacacccatgtatggcgatcagtttgtgaacaccgccgccttg
gttcagcgtggaatggccacgatcttgaactacgaggaaatcggggagaacagcgtaata
cgtgccctgaaaaaggcattggacaaaaaatattacgatgccgccaaggccgtctcccac
tcgtacaaccatcgcccgcagcaggctctgcagacggccttgtggtgggtggagcatgtg
gctcacactggcggtgctcccctgctccagcccagcgccgtgcatatgtcccgcttcgtt
tactactccctcgactgctatgcggtcgtggctcttctcctggccattatcatcggcagt
tggctggccctcattcgacgctgctgcggctccaaatcttccgcaaagcccaagagggac
taa

DBGET integrated database retrieval system