KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14617Help
Entry
Dpse_GA14617      CDS       T01032                                 

Definition
GA14617 gene product from transcript GA14617-RA (EC:3.5.1.-)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dpse_GA14617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1295 aa AA seqDB search
MSSPDDRIPIHDLPPEAGSDERLLHIGPVPLTLDFKPHPAVDIDQQIMELKKNQELQKQR
LIHSFQEKSKQMELEHKLQLEHKYQFAVHSHGAFQELREQTMVTAAAAAAAAVVEEHHRQ
QQQQQQHHHHHHHQQQQQQQQQQQQQHHHQQQREQQQQRERREREVMKRKENCSANASPE
VKQILNCFIMSRKSQAAASNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPPS
SLLKYESDFPLRKTASEPNLLKIRLKQSVIERKARNGGPAGARRHERLLQAAQRRQQKNS
VLTNSNSTPDSGPNSPPSSTGLSVGVVGSRGSPTSAPIQEENEEGSQYQPGQRSSINDLP
LFSSPSLPNISLGRPHLPNSAQVQAQAQAQAQAQAQASAQAQAQAQARATAMFAALHQHV
AAAGGQPTYYNQLGMSFVGRQPTGPLAMMPATGIAPQQPSPVVRSASATSTSSSQASLVG
DVAPPQAHAASTILPSSSSYMQQLGGVTAGSAVNLHAAAVAAAAAAAAAAAGSLPPTNSH
GHGHGYGHGHGHGHGHGHGHGHALYGGHPHNTPITDAQVAQVHLHKQGHRPLGRTQSAPL
PLGHPMLTGAGQLNVAQTHYENSEAERQAYQHQVLTQKLRQTVLTRSGAATAAGVRESQL
KEEEDDSAAEVMDLTDKKKPPKTVLTSTIATSTSQSLPEALAAAAAVYRTSPSAATTPSA
AVAGGSGTKVNSLQRDQEYLQQQRELLLLQNKEELAKRLMRPLSRTLSSPLVPLGPHGLS
QLADTGQGQGQQLPPIATSSSADHIPPVNLTLPHRQHRQFMNHFYTANLQHQRQQQQQQQ
QQQQEQQHLQQTPPSASLPPHKITTGLAYDPLMLKHSCICGDNAQHPEHSGRLQSVWARL
NETDLVKRCDRLRARKATQEELQTVHTEAHAMLFGSNQCQLTRPKLETTLAASFVRLSCG
GLGVDLDTTWNEHHTATAARMAAGCVIDLAFKTAKGDLRNGFAVVRPPGHHAEANLAMGF
CFFNSIAIAAKRLRQQMPEMRRILIVDWDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFF
PGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRTVVMPIAKGFNPDIVLVSS
GFDAATGHPAPLGGYHVSPACFGFMTRELLQLANGKVVLALEGGYDLAAICDSAQECVRA
LLGDPAAPISQSELERPPCQNAINTLQKTIAIQQTHWPCVRMLEHTVGLSALETLKVEHE
ESETINAMAGLSMQSMHRTLSRDDSEEPMDQDETK
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcctgacgacagaataccaatacacgatctgccaccagaagccggaagcgat
gaacgattgctgcatatagggccagtcccgttgacattggatttcaagccccatccagcg
gtggatatcgatcagcagatcatggagcttaaaaagaatcaggaactgcagaagcaacgt
ctgatccactcgtttcaggagaaatcgaagcaaatggaattggagcataaactgcaattg
gagcacaagtatcaatttgcggtgcactcccatggagccttccaggaattgcgggagcag
accatggtaacggccgccgctgctgctgccgccgcagttgtcgaggagcaccaccgccag
cagcagcagcagcagcagcatcaccaccaccaccaccatcagcaacagcagcagcagcag
cagcaacagcagcagcaacatcatcatcagcagcagcgcgagcagcagcagcagcgggag
cgccgagagcgggaggtcatgaagcggaaggagaactgcagcgccaacgccagcccggag
gtcaaacagattctcaattgcttcattatgagccgcaagtcgcaggcagcagcctccaat
ggaacaacgacaacgtcgccctatcgcaatcgaggtgtggtgaaaagctcctcgggcgag
tccctgccagccggaaccgtgaccagtgcgcacccctacaaaatacctcagccgccctcc
tcactgctcaaatatgaatctgattttccgctcaggaaaacagcatccgaacccaacctg
ctgaagatccggctgaaacagagtgtcatcgagcgcaaggcccgtaacggaggcccggca
ggtgcacgtcgccacgagcgactcctgcaggcggcccagcgcaggcagcagaagaactcc
gttcttacaaactccaacagcacgccggactctggccctaactctccgccctcgtccacg
gggctgtcggtgggcgtggtcgggagcaggggttccccgacgagtgctccgatccaggag
gagaacgaggaggggagccagtaccagccggggcagaggagcagcatcaacgacctgccc
ctgttcagctcgccctccctgcccaacatatccctgggacgaccgcatttaccaaactcc
gcccaggtgcaggcgcaggcacaggcacaggcgcaggcacaggcacaggcgagtgcccag
gcccaggcgcaggcgcaggcgcgggctacggcgatgttcgcggcactgcaccagcatgtg
gcggccgccgggggccagccgacctactacaatcagctgggtatgtccttcgtgggacgg
cagccgactgggccgctggccatgatgccggccacgggcatcgcgccccagcagccttcg
cccgtggtcaggtccgcctcggcgacgtctacgtcctcgtcccaggcctccctggtgggg
gatgtggctccgccgcaggcgcacgccgcctccaccattctgccctcgtcctcgtcctac
atgcagcagctggggggagtgaccgccggctccgcagtcaatctgcatgcggcggccgtg
gctgcagcagcagcggcggcggcagcagcggccggctccctgccccccaccaacagccac
ggacacgggcatggctatggtcacggtcacggccatggacacggtcatggacacgggcat
ggtcatgctctgtacggcggacacccgcacaacacaccaatcacggatgcacaggtggct
caggtgcatctgcacaagcagggccaccgacccttgggcaggactcagtcggccccgctg
cccctgggacatccgatgctgacgggcgccgggcagctgaatgtggcccaaacgcattac
gagaacagcgaggcggagcgtcaggcgtaccagcatcaggtgctcacccagaagctgcgc
cagaccgtgctcacccgcagcggagctgcgacggccgctggagtgcgcgagtcccaactg
aaggaggaggaggacgactccgccgcggaggtgatggacctgaccgataaaaagaaaccg
cccaaaacggtactgaccagcaccatagccaccagcacctcacagagtctgcccgaggct
ctggccgccgcagcagcagtctatcgcacgagcccttcagccgccaccacgccctcagca
gcggtggccggcgggagcgggaccaaggtcaatagcctacagcgggaccaggagtacctt
cagcagcagcgcgagctgcttctgctacaaaataaggaggagctggccaagcgcctgatg
cggcccctctctcgcacgctgagtagtccgctggtgccactcggaccgcacggccttagc
cagctggcagacacggggcaagggcaagggcagcagctgccgccaatagccacctcctcg
tcggcggatcacataccgcccgtcaacctgacgctgccccatcgccagcaccgacagttc
atgaatcatttctataccgccaacctgcagcatcagcgccagcagcagcagcaacagcag
cagcagcagcaggagcaacagcacctgcaacagacgccgccgtccgcctcattgcccccg
cacaaaatcaccacgggcctggcctacgatccgctgatgctgaagcactcttgcatctgc
ggcgacaacgcacagcatccggagcacagcggccggctgcagagcgtgtgggcccggtta
aacgaaacggatctggtaaagcgctgcgaccgactgcgggcccgaaaggcaacccaggag
gagctgcagacagtgcacacggaggcgcatgcgatgctcttcggctccaaccagtgccag
ctgacgcgacccaaactggagaccacgctggccgccagcttcgtccgcctctcttgcggg
gggctgggcgtggacctggacaccacgtggaatgagcaccacacggccaccgccgcccgc
atggcagctggctgtgtgatcgatctggccttcaagacggccaagggagatctgcgcaac
ggattcgccgtcgtccggccgcccggccaccatgcggaggccaatctggccatgggcttc
tgcttcttcaactcgatcgccatcgccgccaaacggctgcgccagcagatgcccgagatg
aggcgcattctcattgtcgattgggatgtacaccatggcaatggcactcagcaagcattc
taccaaagtcccgacattctatatctttccatacatcgacacgatgacggtaacttcttt
cccggcacaggcggacccacagagtgcggctccggtgctggtctaggcttcaatgtgaac
atctcgtggtccggggccttgaacccgccgctgggcgatgccgagtatatcgctgcattc
cgaaccgttgtgatgcccatcgccaagggcttcaacccggacattgtgctcgtctcgtcc
ggcttcgatgcggccaccggccacccggcaccactgggcggctatcacgtgtcgcccgct
tgcttcggcttcatgacccgcgagctcctccagctggccaacggcaaggtggtgctggcc
ctcgagggcggctacgacctggccgccatctgtgattccgcccaagagtgcgtccgagct
ctgctcggcgatcccgccgcgcccatttcccagtccgagctggaacggccgccctgtcag
aatgccatcaatacgctccaaaaaacgatagccattcagcaaacgcattggccctgcgtg
aggatgctggagcatactgtcggcctgtctgcgctggagacgctcaaggtggagcacgaa
gaatctgaaacgatcaacgccatggccggcctctcaatgcaatcgatgcacagaacccta
tcgcgcgatgactccgaagaaccgatggatcaggatgaaacgaaatag

DBGET integrated database retrieval system