KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14705Help
Entry
Dpse_GA14705      CDS       T01032                                 

Definition
GA14705 gene product from transcript GA14705-RA (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dpse_GA14705
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dpse_GA14705
   00603 Glycosphingolipid biosynthesis - globo series
    Dpse_GA14705
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dpse_GA14705
   00511 Other glycan degradation
    Dpse_GA14705
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA14705
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dpse_GA14705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 617 aa AA seqDB search
MRFSGHNRYPCSSATAALAFCVCLALGAGPTQGDDSAEAIASSSRKWLCSQTDICTSEDD
MEDGAQYLEERFESQRDCRLSCGKYGSIWPMPTGEECSLSHERVHFDPWKVRFHVVAPSE
VTTQFLRETNRLFVSNLLKECTRNCTLASSKQILVRATVSSDSLVLDWRTDESYSMVLRT
TETATFVDIQAATVYGARHSFETLSNLVAGSVTNGLLLVSAARISDRPAFPHRGVLLDTS
RNFIPLRYLRSTLDAMAASKMNVLHWHVVDTHSFPLEITRVPEMQRYGAYSASQTYSRTD
SVNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPWRRFCVQPPCGQ
LNPLNDHMYAVLKEILEDVAEVGAPEETVHMGGDEVFLPCWNNTEEIVTKMRAQGYDLSE
QSFLRLWSQFHQRNLNAWDDINERMYPSIKEPKPVILWSSHLTVPKYIETFLPKERFIIQ
TWVDSQDPLNRDLLQRGYRLIVSTKNAWYLDHGFWGSTSYYNWRTVYASGMPMGNHGNQV
LGGEVCMWSEFVDHNSLESRIWPRAGAAAERLWSNPKSSALVAQRRFYRYRERLLARGIH
ADAVIPRWCVLHEGRCL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcagcggccacaaccgttatccctgctcgtcggcgacagcggcgctggcattc
tgcgtttgcctagcccttggcgcaggaccgacgcagggcgacgacagcgccgaggcgatc
gccagcagcagcagaaagtggctctgcagccaaacggacatctgtacgtccgaggatgat
atggaggatggggcgcagtatctggaggagcgattcgagagccaaagggactgccggctg
tcgtgcggcaagtatggatccatctggccgatgccaacgggggaggagtgcagcctgtcg
cacgagcgggtgcactttgatccgtggaaggtgcgcttccatgtggtggcccccagcgag
gtgaccacgcagttcctgcgcgagacgaaccgcctgtttgtgagcaatctgctcaaggag
tgcacccgcaactgcacattggccagcagcaagcagatcctcgtgcgggccactgtgagc
agcgacagtctcgtcctcgattggcgcacggacgagagctactcgatggtgctccgcacc
acggagacggccaccttcgtggacatccaggcggcgacagtgtacggagcgaggcactcc
ttcgagacgctcagcaacctggtggcggggagcgtgaccaacggcctgctcctcgttagc
gccgcccgcatctccgatcgtcccgccttcccgcatcgcggcgtgctcctggacacctcg
cgcaacttcataccgctgcggtatctgcgcagcaccctcgacgccatggccgcctccaag
atgaacgtcctccattggcatgtggtggacacgcacagcttcccgcttgagatcacccgt
gtgccggagatgcagcgctacggcgcgtactccgcttcgcagacctactcccgcacggat
tccgtcaatctggtgaagtatgcccgcctccggggcatccgcatcctcattgagatcgat
gggccttcgcacgcgggcaacgggtggcagtggggcccggcggcgggcctgggtaacatg
tccgtgtgcctgaatcagtcgccctggcggcgcttctgcgtgcagccgccgtgcggtcag
ctgaaccccctgaacgatcacatgtacgcggtgctgaaggagatcctcgaggatgtggcc
gaggtgggggcaccagaggagaccgtgcacatgggcggcgacgaggtgtttctcccgtgc
tggaacaacacggaggagatcgtgacgaagatgcgggcccagggctacgatctcagcgag
cagagcttcctccggctgtggtcgcaattccatcagcggaatcttaacgcctgggacgac
atcaacgagcgcatgtatcccagcatcaaagagcccaagccagtgatcctctggtccagc
cacctgaccgttccgaagtacattgagaccttcctgcccaaggagcggttcatcatccag
acgtgggtggactcccaggaccccctcaaccgggacctgctgcaacgcggctaccgcctg
attgtttccaccaagaacgcctggtatctggaccacggcttctggggcagcaccagctac
tacaactggcgcacagtctacgccagcggcatgccgatgggcaatcacggcaaccaggtc
ctcggcggagaggtgtgcatgtggagcgagtttgtcgatcacaactccttggagtcccgc
atctggccacgagctggtgcggccgccgaacgcctctggtcgaatccaaagtcctcggct
ctggtggcccagcgtcgcttctatcgctatcgagagcggctcctggcacgtggcatccat
gcggacgccgtcatcccccgctggtgtgtcctacacgagggcaggtgtctctag

DBGET integrated database retrieval system