KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14714Help
Entry
Dpse_GA14714      CDS       T01032                                 

Definition
GA14714 gene product from transcript GA14714-RA
Orthology
K08738  
cytochrome c
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dpse_GA14714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccacaccgtggaggctggtggcaagcacaaggtcggtcccaatctgcatggtctg
atcggtcgcaagactggccaggctgccggtttcgcatacacggacgccaacaaggccaag
ggaatcacctggaatgaggataccctcttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaatgagcgcggtgatctgatt
gcctacctgaagtctgccaccaagtaa

DBGET integrated database retrieval system