KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14718Help
Entry
Dpse_GA14718      CDS       T01032                                 

Definition
GA14718 gene product from transcript GA14718-RA (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dpse_GA14718
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Dpse_GA14718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 640 aa AA seqDB search
MGSLQHSLVYALAAALLILSLHLSGVCGVIDRLVVQTSSGPVRGRSVTVQGREVHVYTGI
PYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEIWNPNTNVSED
CLYINVWAPAKARLRHGRGANGAEHSGSKPADTDHLIHNGNPQNTTNGLPILIWIYGGGF
MTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPADFAEEAPGNVGLWDQA
LAIRWLKENAHAFGGNPEWMTMFGESAGSSSVNAQLVSPVTRGVVKRAMMQSGTMNAPWS
HMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRAVDAKTISVQQWNSYSGILSFPS
APTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDK
YLEIMNNIFGKATQAEREAIIFQYTSWEGNPGYQNQQQIGHAVGDHFFTCPTNEYAQALA
ERGASVHYYFFKHRSSTSLWGEWMGVMHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKSGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRS
WAGTGCDGDSGSASISPRLQLLLLAGLLYIGAALRTKGVF
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccttcagcacagcctcgtctatgcgctggccgcggcgctgctgatactttcg
ctgcacctctccggcgtctgcggcgtcatcgatcgcctggtggtgcagacatcgtcgggg
ccggtgcgcggccgctcggtgacggtgcagggccgcgaagtgcacgtctacacgggcatc
ccctacgccaagccgccagtcgaggacctgcgctttcgcaaaccggtaccggcggagccc
tggcacggcgtcctagacgccactcgtctatccgcgacctgcgtccaagagcgctacgaa
tactttccgggcttctccggcgaggagatctggaaccccaacaccaatgtttccgaggac
tgcctgtacatcaacgtttgggcgccggccaaggcgcgtctacgccatggaagaggcgcc
aatggtgccgagcactcgggctccaagccggcggacacggaccacctgatccacaatggt
aatccgcagaacacgaccaatggattgcccattctgatctggatctacggagggggattc
atgaccggctcggccaccctggacatctacaatgcggacatcatggcggccgtggggaat
gtgatagtggcctccttccagtatcgcgtgggggcctttggtttcctccatctggcgccg
gaaatgccggcagactttgccgaggaggcacccggcaatgtggggctctgggaccaggcg
ctggccattcgctggctgaaggaaaacgcgcacgccttcggcggcaatcccgagtggatg
accatgttcggggagtcggcgggctccagctcggtgaacgcccagctggtgtcgcccgtg
acgcggggcgtggtcaagcgggccatgatgcagtcgggcaccatgaacgcaccctggagc
cacatgacctccgagaaggccgtggagatcggcaaagcgctgatcaacgactgcaactgc
aatgcctccatgctgaagaccaatcccgctcacgtgatgagctgcatgcgggccgtggac
gccaagaccatttcggtgcagcaatggaactcgtactcgggcatcctcagcttcccatct
gccccgaccatagacggggccttcctgccggcggatcccatgaccctgatgaagacggcg
gatctcaaggactacgacatactaatgggaaatgtcagggatgagggtacctacttcttg
ctgtacgatttcatcgattacttcgataaggacgatgccaccgccctgccgcgcgacaag
tatttggagattatgaacaacattttcggcaaagcaacacaggcggagcgagaggccatc
atattccagtacaccagctgggagggcaatccgggctatcagaaccagcagcaaatcgga
cacgccgtgggcgatcacttcttcacctgccccaccaacgagtatgcccaggcgctggcc
gagcgaggcgcctctgtgcactactacttctttaaacatcgctcaagcacctcgctgtgg
ggcgagtggatgggcgtgatgcacggcgacgagattgagtacttcttcggccagccgctg
aacaactctctgcagtatcgacctgtggagcgcgagttgggcaagcgtatgctcagtgcg
gtcatcgagtttgccaagtccggcaaccccgcccaagatggcgaggagtggccaaacttc
tccaaggaggatcccgtctactacatattcagcacggatgacaagatcgagaaactggca
cgcggccccttggcggcccgctgttccttctggaacgactacttaccgaaagtcaggagt
tgggcaggtacaggttgcgatggcgactcgggaagtgcttccatatcccccaggctgcag
ctcctgttgctggctggactgctctacatcggtgccgccttgagaaccaaaggagttttc
taa

DBGET integrated database retrieval system