KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14768Help
Entry
Dpse_GA14768      CDS       T01032                                 

Definition
GA14768 gene product from transcript GA14768-RA
Orthology
K08701  
nuclear receptor subfamily 1 group D member 3
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 897 aa AA seqDB search
MDVYQIELEAQAQIRSNLLVETCVKQPQQPPQQQQQLHSLKEKEDSHIKDFDGNEQDQDE
EEAEDEEEEEEEDDDNEEEDEDGDGDGDEERPLLPEVNFDANSDFNLHFFDTPEDSSTQG
AYSEAASLDSDQDQVEDPQQHQRELQDCLSAIEAADADPLQLLQCDDYYGPSAASEGVAT
PVIATSATAPHPHPHHSHNQNPHQNPHQNANANANPNTHHHQQQLNCTLSNGRGALYTIS
SVHQFGPASSSGHHHSSSPSSSGAHASPDSGCSSASSTSSHAVSSSSSSSSSSNNCSPSS
ISIALSAAGSSCSSSAATSSSVAHLNKEPQQQQQQQPQTTQQQQQHSHQQQQLQQHPQQQ
QQQQQQQQSFGLADTSNNNNNNNSSNNSGNSSSNSNNGVSSKSFVPCKVCGDKASGYHYG
VTSCEGCKGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLSAGMSRDSVRYG
RVPKRSRELNGAGSTAGGSGATSTSGCPLLAGAPLNVDDSTVNNLHTNQLQPQQQQQQQQ
QQQILQQQPPHVNSVRVKTPSTPQTPQMCSIASSPSELGGCNSATNNNNNNNGSNASGGS
GVGVGVVVVGGHQQMGVGAHTDVGGHQVTMCHDGMAGTANELTVYDVIVCVSQAHRLNCS
YTEELTRELMRRPVTVPQNGIATTVAESLEFQKIWLWQQFSARVTPGVQRIVEFAKRVPG
FCDFTQDDQLILIKLGFFEVWLTHVARLINDTTLTLDDGAYLTRQQLEILYDTDFVNALL
NFANTLNAYGLSDTEIGLFSAMVLLASDRTGLSEPKVIGRARELVAEALRVQILRSRAGS
PQALQLMPALEAKIPELRSLGAKHFSHLDWLRMNWTKLRLPPLFAEIFDIPKADDEL
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggatgtataccaaatagagctggaggcacaggcacaaatccgctccaatcttttggtt
gaaacttgcgtgaagcagccgcagcagccgccgcagcagcagcagcagctccattcgctg
aaggagaaggaggatagccacatcaaggactttgacggcaacgagcaagaccaggacgag
gaagaggcggaggacgaggaggaggaagaggaggaggacgacgacaacgaagaagaggac
gaggacggtgacggggacggtgacgaagaaaggccacttctcccagaagtcaatttcgat
gcgaattccgatttcaatttgcatttctttgacacgcccgaggactcctcgacccaagga
gcctacagcgaggccgccagcctagactccgaccaggaccaggttgaggatccgcagcag
catcagcgggagctgcaggattgcctaagtgccatcgaggcggcggatgcggatcccctg
cagctgctgcagtgcgacgactactacggcccatccgctgcaagcgagggcgtggcaacg
ccagtcatagccacatctgccactgcaccgcatccccatccacaccactcgcataatcag
aacccacatcagaatccgcaccagaacgcaaacgcaaacgccaatccgaacacacaccac
caccagcagcagctgaactgcaccttgagcaatggtagaggtgctctgtacaccatcagc
agtgtgcatcagttcggtccggccagcagcagcggccaccaccatagcagctccccctcc
tcgagtggggcccacgcctcgccggacagcggctgctcttcggccagctccacctcctcc
cacgccgtctcctcatcatcctccagctctagctccagcaacaactgcagtcccagctcc
atctccatcgccctctcagccgccggttccagctgcagctccagcgcagcaacatcttca
tctgttgcgcatctaaacaaagagccacagcagcagcagcagcagcagccacagacaact
cagcaacagcagcaacactcacatcagcagcaacagttgcaacagcacccccagcagcag
cagcagcagcaacagcaacagcaatcttttggcttagccgacaccagcaacaacaacaac
aacaacaacagcagcaacaacagtggcaacagcagcagcaacagcaacaacggtgtctcc
tcgaagtcgtttgtgccctgtaaagtgtgcggtgacaaggcctccggctaccactatggt
gtaacctcctgcgagggttgcaagggcttctttcgtcgcagcatccagaagcagatcgag
taccgctgcctaagggacggcaagtgtctggtcatccgcctgaaccgcaatcgctgccaa
tattgccgcttcaagaaatgcctctccgctggcatgagccgcgactctgtacgttatggt
cgcgttcccaagcgatcccgtgagttgaacggagcagggtccactgcaggaggatctgga
gccacttccacatctggatgccctttgttggccggtgcgccgctaaatgtggatgattcc
acggtgaacaatttgcatacaaatcaactgcagccacagcaacagcaacaacaacagcaa
cagcaacaaatattacagcagcagccgccgcacgtgaacagcgtccgtgtgaagacaccg
agtacaccacaaacgccacaaatgtgttcgattgcctcctcgccatcggagctgggcggt
tgcaatagtgccaccaacaacaataacaacaacaacggcagcaatgccagcgggggtagc
ggcgtgggcgtgggtgttgtagttgtcggcggacaccagcaaatgggcgtgggtgcccat
accgatgtcggtggtcatcaggtgaccatgtgccacgacggcatggccggcacggccaac
gagctgacagtctacgatgtgatcgtttgcgtctcgcaggcgcatcgcctcaactgctcc
tacacggaggagctgacgcgggaactgatgcgacgtccagtgacggtgccacagaatggc
attgccaccacagtagcggagagcctggagtttcagaagatctggctctggcagcaattc
tcggccagggtgacgcccggcgtccagcggattgtggagtttgcgaaacgcgtacctggc
ttctgtgatttcacgcaagatgaccagctgatcctgattaaactgggcttcttcgaggtg
tggctcacccatgtggcgcgtctcatcaacgacacgactctgacgctagacgatggcgcc
tatctgacacgccagcagctggagatactctatgataccgactttgtcaatgccttgctg
aactttgccaatacgctgaatgcctacgggctgagcgacaccgagatcggcctattttcg
gccatggtgctgctggcctcggaccggaccggactcagtgagccgaaggtgattggacgg
gctcgggagctggtggccgaggcgctacgcgttcagatcctgcgctcccgggccggatcc
ccgcaggcgctacagctgatgcccgcgctggaggctaagatccccgaactgcgctcgctg
ggggccaagcacttctcccatctagactggctacggatgaactggaccaagctgcgactg
ccgccgctcttcgcggagatcttcgatatacccaaggccgacgacgagctgtag

DBGET integrated database retrieval system