KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14794Help
Entry
Dpse_GA14794      CDS       T01032                                 

Definition
GA14794 gene product from transcript GA14794-RA (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dpo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 356 aa AA seqDB search
MLGSRNLASRCVRLARSKTTTSSSSRAKASVVAEQSLGIIGVPFAKGQGKQGVELAPDLL
RQSNLRQVLQSSHDGLVIRDYGNLQYAVDETLLQQQRVHYHHIRNYADFMACNRALIEQV
KIMLQQNSQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHNTSQSGNIHGMP
VSFLLEQLRTTWQHACLDEIAPNCLPKDQLVYIGLRDIDPYEAFILNKFGIRYYAMDTID
RVGVPKIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRD
TKRVQGVDLVEINPKLGNERDVRTTVDSGLEILKSMFGYRRSGHWSNIDTGILGSD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttggggagtcgaaacttagcctcaaggtgtgtgcgcctggcgcgctcgaagaccacc
accagcagcagctccagggctaaggcatccgtagtggccgaacagagtctgggcatcatc
ggggtgccctttgccaagggccagggcaagcagggcgtcgagcttgcaccggacctgctg
cgtcagagtaatctgcgtcaagtgctccagagcagtcacgatggactggtgatccgggac
tatggaaacctgcagtatgccgtggatgagacgctgttgcagcagcagcgcgtccactac
catcacatccgcaactacgccgatttcatggcctgcaaccgggccctgatcgagcaggtg
aagataatgttgcagcagaactcccagtttctggccattggcggggaccatgccatcggt
ttcggttctgtggccggtcatctgcagcatacaccgaatctgtctctggtgtggatcgac
gcgcatgcggatatcaatctgcacaacacctcgcagtcgggcaacatacatgggatgccc
gtctcgtttctgctggagcagctccgcaccacctggcagcatgcgtgcctcgacgagatc
gctcccaactgtttgccgaaggatcagttggtttacattggactgagggacattgacccc
tacgaggcgttcatattgaataaatttggaatacgctactatgctatggatacaatcgat
cgcgtgggtgtgccgaaaatcatcgagatgaccctggatgctctgaatccacagaacaag
atccacgttagcttcgacatcgatgcgcttgacagcaacgtggcgcccagcactggcaca
gccgttcgcggcggcctcacgttgcgcgagggcatcagtattgtggaggcgctgcgggac
acaaagagggtgcagggtgtagacctggtggagatcaatccaaagctgggaaatgaacgc
gacgtacgcaccaccgtcgactccggcctggagatcctcaagagcatgttcggctatcgg
cgctctggccactggagtaacatcgatacgggaatcctgggaagcgattga

DBGET integrated database retrieval system